ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_110700 (PP1)

serine/threonine protein phosphatase, putative, a gene from Toxoplasma gondii

Compiled localisation
cytoplasm and nucleus during tachyzoite

Who localised this protein by microscopy?

Daher, W., Oria, G., Fauquenoy, S., Cailliau, K., Browaeys, E., Tomavo, S., Khalife, J.
A Toxoplasma gondii leucine-rich repeat protein binds phosphatase type 1 protein and negatively regulates its activity. (2007 Sep, Eukaryot Cell) PubMed / full text
   more detail about this publication

cytoplasm and nucleus during tachyzoite
  • "When the tachyzoites were examined for the expression of TgPP1, we observed a weak but specific staining in the nucleus (Fig. 7B). In addition, we observed that polyclonal anti-PP1 antibodies revealed a signal associated with an organelle of the parasite that colocalized with staining obtained with anti-ROP1 antibodies"
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein, cMyc tag
  • Strain: 76K
  • Gene model mapping comments: Blast from DQ437871, annotation doesn't match but gene model agrees with RACE experiments in 17660360
  • Localisation record: nucleus and cytoplasm during tachyzoite
  • Comment: On ToxoDB 4.3: Blast from DQ437871, annotation doesn't match and gene model is currently wrong – comment made
  • Other genes localised in this publication: hypothetical protein, conserved

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10262

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • PF14_0142 serine/threonine protein phosphatase
  • PBANKA_102830 serine/threonine protein phosphatase, putative
  • PY07156 serine/threonine protein phosphatase alpha-3 isoform
  • PVX_085730 ser/thr protein phosphatase, putative
  • PCHAS_102910 serine/threonine protein phosphatase, putative
  • PKH_133280 serine/threonine protein phosphatase, putative
  • NCLIV_054750 hypothetical protein
  • cgd7_2670 serine/threonine protein phosphatase, putative
  • Chro.70303 hypothetical protein
  • CMU_034760 serine/threonine protein phosphatase, putative
  • TP02_0350 serine/threonine protein phosphatase, putative
  • TA12680 serine/threonine protein phosphatase 1, PP1-gamma catalytic subunit, putative
  • BBOV_III006130 Ser/Thr protein phosphatase family protein
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_110700 serine/threonine protein phosphatase, putative
MVSLDVDVDAVISKLLEVRGSRPGKPVQLTEAEIRGLCHKSREIFISQPILLELEAPIKICGDIHGQYYDLLRLFEYGGF
PPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPV
AAIIDEKIFCMHGGLSPELNSMDQIRRIVRPTDVPDTGLLCDLLWSDPEKEISGWGENDRGVSFTFGQDVVHNFLRKHDL
DLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPVEKKKGMAK

Gene-Specific Links for TGME49_110700

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins