ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_110470 ()

cytochrome c oxidase subunit II, putative, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_12527

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • PF14_0288 cytochrome c oxidase subunit II precursor, putative
  • PBANKA_101380 cytochrome c oxidase subunit II precursor, putative
  • PY01261 cytochrome c oxidase subunit II
  • PVX_084995 cytochrome c oxidase subunit II precursor, putative
  • PCHAS_101460 cytochrome c oxidase subunit II precursor, putative
  • PKH_131940 cytochrome c oxidase subunit II precursor, putative
  • TGME49_110470 cytochrome c oxidase subunit II, putative
  • NCLIV_054550 Cytochrome c oxidase subunit 2, related
  • TP01_0683 cytochrome c oxidase subunit II precursor, putative
  • TA02790 cytochrome C oxidase subunit II (COX2 homologue), putative
  • BBOV_IV010440 cytochrome c oxidase subunit 2, putative
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>TGME49_110470 cytochrome c oxidase subunit II, putative
MDVFRSFWNRRGAAPGGAATSSGRPAGCREENSSVLLQSLKANSQQKKGETPLQNVAAADYVTPQKYLDDPDKIPTYYVF
QSNMVTDEDLLPGMLRNLEVDKRLTLPTRTHIRFLITATDVIHSWAVPALGIKADAIPGRLQRINTFIQREGVFYGQCSE
LCGALHGFMPIVIEAVSPETYAAHAKKWYKD

Gene-Specific Links for TGME49_110470

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins