ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_110460 (Rab6)

RAB6 protein, a gene from Toxoplasma gondii

Compiled localisation
cisternal rims of the late golgi and endosomal membrane and golgi associated transport vesicle and microdomains of dense granule membrane and not apicoplast and not microneme and not nucleus and not rhoptry and trans-golgi network during intracellular tachyzoite

Who localised this protein by microscopy?

Stedman, T. T., Sussmann, A. R., Joiner, K. A.
Toxoplasma gondii Rab6 mediates a retrograde pathway for sorting of constitutively secreted proteins to the Golgi complex. (2003 Feb 14, J Biol Chem) PubMed / full text
   more detail about this publication

cisternal rims of the late golgi and endosomal membrane and golgi associated transport vesicle and microdomains of dense granule membrane and trans-golgi network and not apicoplast and not microneme and not nucleus and not rhoptry during intracellular tachyzoite
  • "Immunogold labeling was enriched at the lateral ends of the trans-most Golgi (Go) cisternae (A), on microdomains of dense granule (DG) membranes (B, C, and E), on lucent vacuole membranes (E), and associated with cytoplasmic centrosomes (Ce) (D). No labeling was observed in rhoptries (Rh), micronemes (Mi), apicoplasts (Ap), and the nucleus (Nu)."
  • Microscopy type: Light, EM
  • Microscopy method: HA tag
  • Strain: RH
  • Gene model mapping comments: blast from AF228419, annotation matches
  • Localisation record: cisternal rims of the late Golgi and trans-Golgi network and golgi associated transport vesicles and microdomains of dense granule membrane and endosomal membranes and not rhoptry and not microneme and not apicoplast and not nucleus during intracellular tachyzoite
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10702

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_110460 RAB6 protein
MAEATVAGLNKYKLVFLGEQAVGKTSIITRFMYDTFDNNYQATIGIDFLSKTLYLEDRTVRLQLWDTAGQERFRSLIPSY
IRDSSAAVVVYDITNRASFLNTTKWIEDVRAERGNDVIISLVGNKTDLADRRQVSYEEGRQKAQEHDIMFVETSAKAGYN
IKNLFRKLASALPGLETQQTASDAQMVDVQLNATPQQQDLTSKTSSCSC

Gene-Specific Links for TGME49_110460

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins