ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_110440 (MORN1)

phosphatidylinositol-4-phosphate 5-kinase, putative, a gene from Toxoplasma gondii

Compiled localisation
centrocone and ring structure at apical inner membrane complex and ring structure at posterior inner membrane complex during tachyzoite
cap at basal end of daughter and cap at basal end of mother and intracellular
spindle pole during late intracellular tachyzoite and late multinucleate tachyzoite
ring at basal end during tachyzoite daughter cell inner membrane complex formation
apical and cone shaped body of basal complex during late intracellular tachyzoite
inner membrane complex and posterior extremity of cup-shaped inner membrane cytoskeleton scaffolds during late multinucleate tachyzoite
during not early multinucleate tachyzoite and not macrogamete
nuclear pole during proliferative microgametocyte
flagellate basal body during flagellate growth
adjacent to mitochondrion and electron dense collar during microgametocytogeny
anterior adjacent to mitochondrion during extracellular microgamete and mature microgametogeny
basal complex during early tachyzoite cell division and intracellular tachyzoite and late tachyzoite cell division

Who localised this protein by microscopy?

Anderson-White, B. R., Ivey, F. D., Cheng, K., Szatanek, T., Lorestani, A., Beckers, C. J., Ferguson, D. J., Sahoo, N., Gubbels, M. J.
A family of intermediate filament-like proteins is sequentially assembled into the cytoskeleton of Toxoplasma gondii. (2011 Jan, Cell Microbiol) PubMed / full text
   more detail about this publication

basal complex during intracellular tachyzoite

Heaslip, A. T., Dzierszinski, F., Stein, B., Hu, K.
TgMORN1 is a key organizer for the basal complex of Toxoplasma gondii. (2010 Feb, PLoS Pathog) PubMed / full text
   more detail about this publication

basal complex during early tachyzoite cell division and late tachyzoite cell division
  • "Figure 1. TgMORN1 is a component of the basal complex and forms rings and fibers when ectopically expressed in E. coli."
  • Microscopy type: Light
  • Microscopy method: GFP tag
  • Strain:
  • Gene model mapping comments: inferred from another publication
  • Localisation record: basal complex during beginning of cell division and late stage of cell division
  • Comment: strain information not found
  • Other genes localised in this publication: membrane skeletal protein IMC1

van Dooren, G. G., Reiff, S. B., Tomova, C., Meissner, M., Humbel, B. M., Striepen, B.
A novel dynamin-related protein has been recruited for apicoplast fission in Toxoplasma gondii. (2009 Feb 24, Curr Biol) PubMed / full text
   more detail about this publication

centrocone and intracellular
  • "YFP-MORN1 labels the basal end of the parasites, the centrocone (an extension of the nuclear envelope that localizes adjacent to the centrosome), and the growing bud of the daughter cell."
  • Microscopy type: Light
  • Microscopy method: YFP tag
  • Strain:
  • Gene model mapping comments: inferred from another publication
  • Localisation record: centrocone and growing bud of daughter cell
  • Comment: strain information not found
  • Other genes localised in this publication: dynamin-like protein, putative, acyl carrier protein, membrane skeletal protein IMC1

Ferguson, D. J., Sahoo, N., Pinches, R. A., Bumstead, J. M., Tomley, F. M., Gubbels, M. J.
MORN1 has a conserved role in asexual and sexual development across the apicomplexa. (2008 Apr, Eukaryot Cell) PubMed / full text
   more detail about this publication

inner membrane complex and posterior extremity of cup-shaped inner membrane cytoskeleton scaffolds and spindle pole during late multinucleate tachyzoite, during not early multinucleate tachyzoite and not macrogamete, nuclear pole during proliferative microgametocyte, flagellate basal body during flagellate growth, adjacent to mitochondrion and electron dense collar during microgametocytogeny, anterior adjacent to mitochondrion during extracellular microgamete and mature microgametogeny
  • "Note the gold particles localizing to the spindle poles (NS) of the multiple nuclei (N) and the posterior extremities of the cup-shaped (arrowheads), newly forming, inner membrane cytoskeleton scaffolds (I). In addition, one IMC has been cut tangentially through the base of the cone, showing gold particles along its length (parallel arrows in the lower right corner). Sexual development was studied across four coccidian species: T. gondii, E acervulina, E. tenella, and E. maxima. They developed in similar manners and varied only in size and the number of gametes formed. Therefore, coccidian sexual development will be represented in a combined description without differentiating between the species."
  • Microscopy type: Light, EM
  • Microscopy method: polyclonal antibody directly to protein
  • Strain:
  • Gene model mapping comments: inferred from another publication
  • Localisation record: spindle pole and posterior extremity of cup-shaped inner membrane cytoskeleton scaffolds and IMC during late multinucleate tachyzoite, not during early multinucleate tachyzoite, not during macrogamete, nuclear pole during proliferative microgametocyte, flagellar basal bodies during flagellate growth, electron dense collar and adjacent to mitochondrion during microgametogeny, anterior adjacent to mitochondria during mature microgametogeny and free microgamete
  • Comment: strain information not found
  • Other genes localised in this publication: MORN repeat protein, putative, membrane skeletal protein IMC1, enolase 2, enoyl-acyl carrier reductase, Nothing has been found, Nothing has been found, gi|50295339|gb|AY566297.1| Eimeria tenella enoyl-acyl carrier reductase (ENR) mRNA, complete cds, Nothing has been found

Hu, K.
Organizational changes of the daughter basal complex during the parasite replication of Toxoplasma gondii. (2008 Jan, PLoS Pathog) PubMed / full text
   more detail about this publication

apical and cone shaped body of basal complex and spindle pole during late intracellular tachyzoite
  • "The TgMORN1 compartment is shaped into a cone that forms the main body of the basal complex (Figure 1A-1E), whereas TgCentrin2 is concentrated at the posterior tip of the basal complex (Figure 1D and 1F). Both TgCentrin2 and TgMORN1 are also components of the apical complex. In addition, they are localized to the spindle pole and the centrioles, respectively."
  • Microscopy type: Light
  • Microscopy method: GFP tag, mCherry tag
  • Strain: RH
  • Gene model mapping comments: inferred from another publication
  • Localisation record: Cone shaped body of basal complex and apical and spindle pole during mature intracellular tachyzoite
  • Other genes localised in this publication: caltractin, putative, membrane skeletal protein IMC1, putative, tubulin alpha chain

Shea, M., Jakle, U., Liu, Q., Berry, C., Joiner, K. A., Soldati-Favre, D.
A family of aspartic proteases and a novel, dynamic and cell-cycle-dependent protease localization in the secretory pathway of Toxoplasma gondii. (2007 Aug, Traffic) PubMed / full text
   more detail about this publication

ring at basal end during tachyzoite daughter cell inner membrane complex formation

Hu, K., Johnson, J., Florens, L., Fraunholz, M., Suravajjala, S., DiLullo, C., Yates, J., Roos, D. S., Murray, J. M.
Cytoskeletal components of an invasion machine--the apical complex of Toxoplasma gondii. (2006 Feb, PLoS Pathog) PubMed / full text
   more detail about this publication

cap at basal end of daughter and cap at basal end of mother and spindle pole
  • "EGFP- or mRFP-tagged TgMORN1 labels the conoid, but its predominant localization is in the form of a cap at the basal end of both mature mothers and developing daughter parasites (Figure 6). In addition, TgMORN1 also shows strong fluorescence at the spindle poles and in a weaker diffuse cloud around the spindle poles. Deconvolved 3D images (Figure 6D) reveal that the basal accumulation in the daughters is actually a ring encircling the basal end of the developing daughter IMC scaffold. "
  • Microscopy type: Light
  • Microscopy method: GFP tag, RFP tag
  • Strain: RH
  • Gene model mapping comments: taken directly from publication
  • Localisation record: cap at basal end of mother and cap at basal end of daughter and spindle poles
  • Other genes localised in this publication: membrane skeletal protein IMC1, putative, calmodulin, putative, calmodulin, putative, dynein light chain, putative, caltractin, putative

Gubbels, M. J., Vaishnava, S., Boot, N., Dubremetz, J. F., Striepen, B.
A MORN-repeat protein is a dynamic component of the Toxoplasma gondii cell division apparatus. (2006 Jun 1, J Cell Sci) PubMed / full text
   more detail about this publication

centrocone and ring structure at apical inner membrane complex and ring structure at posterior inner membrane complex during tachyzoite
  • "MORN1 specifically localizes to ring structures at the apical and posterior end of the inner membrane complex and to the centrocone, a specialized nuclear structure that organizes the mitotic spindle."
  • Microscopy type: Light, EM
  • Microscopy method: antibody directly to protein
  • Strain: RH
  • Gene model mapping comments: blast from DQ181547
  • Localisation record: Ring structure at apical IMC during tachyzoite, Ring structure at posterior IMC during tachyzoite, centrocone during tachyzoite
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_12391

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>TGME49_110440 phosphatidylinositol-4-phosphate 5-kinase, putative
MESCHAYHGQIKDGLFHGKGTLIYSGNEKYEGEFVFGKREGHGRFLYADGATYEGKWVEDRIHGQGVAHFASGNRYEGQW
EMGRINGFGKLSYSNGDEYEGEWVDGKMHGRGTYRYAEGDVYTGEWRDDKRHGKGSVTYVSAKGSVVEKYEGDWVNGKMH
GHGKYIYSDGGVYEGDWIDGKMHGKGTYVFPNGNVYEGEWAHDMKDGYGVLTYQNGEKYEGYWKQDKVHGKGTLTYTRGD
KYIGDWMDAKKDGEGELIYANGDRFKGQWADDRANGFGVFTYANGNRYEGEWTDDKRHGRGVFYCAEDGSAYEGEFVGGR
KEGNGILRLATGHQLEGTWSGGQLVRVTSFVFAQDSPWLNVDL

Gene-Specific Links for TGME49_110440

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins