ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_110160 (-AGO) *

* The amino acid sequence is recorded as differing between ApiLoc and the genome database. See the gene model mapping comments in each localisation for more information.

piwi-PAZ domain-containing protein, a gene from Toxoplasma gondii

Compiled localisation
cytoplasmic foci and nucleus during tachyzoite

Who localised this protein by microscopy?

Braun, L., Cannella, D., Ortet, P., Barakat, M., Sautel, C. F., Kieffer, S., Garin, J., Bastien, O., Voinnet, O., Hakimi, M. A.
A complex small RNA repertoire is generated by a plant/fungal-like machinery and effected by a metazoan-like Argonaute in the single-cell human parasite Toxoplasma gondii. (2010 May, PLoS Pathog) PubMed / full text
   more detail about this publication

cytoplasmic foci and nucleus during tachyzoite
  • "Immunofluorescence and confocal microscopy revealed that Tg-AGO accumulates in tachyzoites mostly as granules of unidentified nature, but this labeling was superimposed over a diffuse cytoplasmic signal (Figure 7B and data not shown). Using acetylated histone H4 as a marker, confocal analyses also revealed a faint nuclear staining indicating that a minor portion of Tg-AGO localizes to the nucleus."
  • Microscopy type: light
  • Microscopy method: HA tag
  • Strain: RH
  • Gene model mapping comments: blast from GU046561, gene model inconsistent?
  • Localisation record: cytoplasmic granules of unidentified nature and minority nucleus during tachyzoite
  • Other genes localised in this publication: histone H4, putative

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10780

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_110160 piwi-PAZ domain-containing protein
MEGYQMFHGVNFFKDMPENFVPLRGPNKAFQIWDGFSQAVAPYQTAGTMSWNAVFNLRACTSTKAIPLVKYIEIQASAIA
KRMVDLSTEKGCRALMADAEVMRRLNRRLRGTKLESFHILNRDTQQPEKRVYKLKELMTFSASSEESRFDLQDGRRVTVL
QHFKETYPHASGIPPFQPLINTRSKDRPAYLPVSIVTLKHQPAREGVTEEDRAQVAEHMIMPPRNRVAKTEQLLSLVFGP
QGHSAPKVLDAFGVILQLEAKTAQGRVLESPLIKYREVPGGGPGRSSKTVRPAQGDWNLRDAAFCRGTVCKVWALYSFVE
TSQNVIENLARVLKTQGAKYGVNLTTKPGLGAYTRNDRRPMLDQFAAFVALAKTKGCELLFVILNERVSLDIYQIVKSCT
DVNFPSQCLNGRHKCIDAIFRGDNPNPQYFANVMSKVNMKLQGVNQTLEADIIKQEIGTDKSTLVLAVETSFFANPTKTS
PPPTAPIVCACTGNMDDDLGAFGHAVCVESRKHPIVTDIGSMFKTILSYRKTTKNWPARIIYLRSATTEAHFPLVLAGEI
RAIEELYVRENRSKPRILAVAVQRRQQTRLFPTKEMQAQGNNLPPGFLLANSLQHPGHFRNFLLISHKALQGTARPTRYY
ILRDDANRDMEKVAQLMYSLCHVYGRCQRAVSIPAPLYYAELLAARAQSYMKVGMRRERNIDIDDLSHLSGEAGEKMLTE
TRHFADEYLRSTAAKVTPMVFC

Gene-Specific Links for TGME49_110160

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins