ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_110040 ()

ubiquitin-conjugating enzyme E2, putative, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_11224

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • PFC0255c ubiquitin conjugating enzyme E2, putative
  • PBANKA_040420 ubiquitin-conjugating enzyme e2, putative
  • PY05886 Plasmodium vivax PV1H14205_P
  • PVX_119410 ubiquitin-conjugating enzyme E2, putative
  • PCHAS_040510 ubiquitin-conjugating enzyme e2, putative
  • PKH_083420 ubiquitin conjugating enzyme E2, putative
  • TGME49_110040 ubiquitin-conjugating enzyme E2, putative
  • NCLIV_054150 Ubiquitin-conjugating enzyme, related
  • cgd8_580 ubiquitin-conjugating enzyme E2, putative
  • CMU_024520 ubiquitin-conjugating enzyme E2, putative
  • TA02645 ubiquitin-conjugating enzyme (MMS homologue), putative
  • BBOV_III004030 conserved hypothetical protein
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_110040 ubiquitin-conjugating enzyme E2, putative
MLYVSLCCAPPRCLFSGWATWYSFLRFFTSRSDFLCLKNVRNAILCRYGTMASREPQERTTYAVVVPRSFRLLDELEKGQ
KGQVAEGVSFGLEEADDISLTKWSGTIFGPPGTAFENRIYCVSINCGPSYPDEPPEVCFRTRINMHSVDPNGVVLRSSFP
LLRAWQRHYTLDLLLTALRQEMAAPANRRLPQPPEGDMY

Gene-Specific Links for TGME49_110040

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins