ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_110000 ()

lung seven transmembrane receptor domain-containing protein, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_11732

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • PFL0765w conserved Plasmodium membrane protein, unknown function
  • PBANKA_143160 conserved Plasmodium protein, unknown function
  • PY02272 hypothetical protein
  • PVX_123475 hypothetical protein, conserved
  • PCHAS_143360 conserved Plasmodium protein, unknown function
  • PKH_143300 receptor putative
  • TGME49_110000 lung seven transmembrane receptor domain-containing protein
  • NCLIV_054110 YHL017Wp-like protein, related
  • cgd8_2950 cervesiae Yh1017wp/PTM1 like protein; signal peptide plus 7 pass transmembrane regions
  • Chro.80344 hypothetical protein
  • CMU_027000 lung seven transmembrane receptor family protein
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_110000 lung seven transmembrane receptor domain-containing protein
MKKSAAPEALSGDSEEDERLPKGPRLCSVGCLDSRLFCTQTPIGASLARCSSVSLFGRVSVAYLTFLSLIICLGLVAAPC
AGQIVTYTKQPVPDPFLLAPEKGAFFVYGKNTKFYFPFNLFGSDPSAALPAPTVTFKNVRLTAEAAAAVRQAQEQGDSDA
SSPPFSPRSPVAVELALLPYAYVRTLFTSPSAAPFCCSARPAAGEGDSHPSFSIPTSFSPTNECPYPGALKRPISGDAVP
LLSSSLGAEGGSTREPTSPRVSSSVREPAGQYVCPLTLSGEASETERVVQMEIEDSDIYFLVASNCGGFKGLAFEGEVAV
RNAYGYLPGYEYPKIPFYFLFMLVYLVVCLVWGCLMYRQRANLITFHKFMLVVAVLGFLESLALFVYLYDYNMRGDRNKV
LLVVSILVTVVKNIFSYMLVLLGAIGWSITIPVLEKKTVVRMQIIVVLYIILDTVRQVSDEFSNSHSLPLVLLLTCLIPI
STLNGVLFYWIISSINNNIEMLQQQKQHEKLLIYRRLYAVLLLAIVLAIIDLLCQIYVASWDASDRWRDQWWLSDAIPHF
LFLLVLAAMMAIWRPSQQSRRLAYFTELGDVDDLENHHARAKNAADLHVWGEELDFHDHFSEEELEAGIPNFKLHSFGSL
SEDGNLSDDDLHGDEEGYHTSSRLTPTSQQLPTPTRSGEGNKPQPQVVGRETLDDEVEMTTQDGASTNGRRLDHGQEGL

Gene-Specific Links for TGME49_110000

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins