ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_109750 (Succinyl-CoA-synthetase (ATP) (SCSb))

succinyl-CoA ligase, putative, a gene from Toxoplasma gondii

Compiled localisation
mitochondrion during tachyzoite

Who localised this protein by microscopy?

Fleige, T., Pfaff, N., Gross, U., Bohne, W.
Localisation of gluconeogenesis and tricarboxylic acid (TCA)-cycle enzymes and first functional analysis of the TCA cycle in Toxoplasma gondii. (2008 Aug, Int J Parasitol) PubMed / full text
   more detail about this publication

mitochondrion during tachyzoite

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10327

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • PF14_0295 ATP-specific succinyl-CoA synthetase beta subunit, putative
  • PBANKA_101320 ATP-specific succinyl-CoA synthetase beta subunit, putative
  • PY02175 succinyl-coa ligase beta-chain, hydrogenosomal precursor
  • PVX_084960 ATP-specific succinyl-CoA synthetase beta subunit, putative
  • PCHAS_101400 ATP-specific succinyl-CoA synthetase beta subunit, putative
  • PKH_131870 ATP-specific succinyl-CoA synthetase beta subunit
  • NCLIV_053880 cDNA FLJ54097, highly similar to Succinyl-CoA ligase (ADP-forming) beta-chain, mitochondrial (EC 6.2.1.5), related
  • CMU_032980 succinyl-CoA synthetase, beta subunit, putative
  • TP01_0677 ATP-specific succinyl-CoA synthetase beta subunit, putative
  • TA02815 succinyl-coA ligase, subunit, putative
  • BBOV_IV010490 succinly CoA-ligase beta subunit, putative
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_109750 succinyl-CoA ligase, putative
MALSAAGVGRQVLSAAARLSCSTSSAPLRATISSVTAASATSSSLLPSLLCATHRATGATSPSHQREQRRFLNLHEYQSM
RIMKEFHITTPKFAVASTAKEAEQEAATFLSESPSGDGEPVDFVVKAQVLAGGRGLGFFRENGYQGGVQVCESPREVGIV
AEKMLGKTLVTKQTGKEGKLCNKVLVTERFFIRKEKYVAILMDRGAGGPILIGSARGGTSIEDIAHNYPESIHKMPIDIN
QGISEPRLREFAELLGFSGDRLEAACQCIRGLYELFRSKDCTQIEVNPLVETHDGRVLVCDAKLNFDDNAGFRQKDIFSQ
RDYSQEDPREVAADAADLNYIGLEGSIGCMVNGAGLAMATMDIIHLHGGSPANFLDVGGGADQHQIIEALKIIQQDKRAN
CVLVNIFGGIMRCDVIAKGLVAAAKEVGFDKPVVLRLEGTNKEAAKEVLKDVLTDPAYSALQLLQEDDFDKAAQLAVKVA
SVVDAAAKANLKVHISAP

Gene-Specific Links for TGME49_109750

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins