ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_109590 (ROP1)

rhoptry protein, putative, a gene from Toxoplasma gondii

Compiled localisation
parasitophorous vacuole during early tachyzoite invasion and tachyzoite invasion
rhoptry during extracellular tachyzoite and intracellular tachyzoite and tachyzoite
parasitophorous vacuole membrane during after tachyzoite invasion
evacuole during tachyzoite invasion

Who localised this protein by microscopy?

Huynh, M. H., Carruthers, V. B.
Tagging of endogenous genes in a Toxoplasma gondii strain lacking Ku80. (2009 Apr, Eukaryot Cell) PubMed / full text
   more detail about this publication

rhoptry

Gordon, J. L., Beatty, W. L., Sibley, L. D.
A novel actin-related protein is associated with daughter cell formation in Toxoplasma gondii. (2008 Sep, Eukaryot Cell) PubMed / full text
   more detail about this publication

rhoptry

Nishi, M., Hu, K., Murray, J. M., Roos, D. S.
Organellar dynamics during the cell cycle of Toxoplasma gondii. (2008 May 1, J Cell Sci) PubMed / full text
   more detail about this publication

rhoptry during intracellular tachyzoite

Shea, M., Jakle, U., Liu, Q., Berry, C., Joiner, K. A., Soldati-Favre, D.
A family of aspartic proteases and a novel, dynamic and cell-cycle-dependent protease localization in the secretory pathway of Toxoplasma gondii. (2007 Aug, Traffic) PubMed / full text
   more detail about this publication

rhoptry during intracellular tachyzoite

Taylor, S., Barragan, A., Su, C., Fux, B., Fentress, S. J., Tang, K., Beatty, W. L., Hajj, H. E., Jerome, M., Behnke, M. S., White, M., Wootton, J. C., Sibley, L. D.
A secreted serine-threonine kinase determines virulence in the eukaryotic pathogen Toxoplasma gondii. (2006 Dec 15, Science) PubMed / full text
   more detail about this publication

rhoptry
  • "Ty epitope–tagged ROP18-I was found in early parasitophorous vacuoles (PVs), where it overlapped with the rhoptry marker ROP1"
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: GT-1
  • Gene model mapping comments: inferred from another publication
  • Localisation record: rhoptries
  • Other genes localised in this publication: Rhoptry kinase family protein ROP18

Miller, S. A., Thathy, V., Ajioka, J. W., Blackman, M. J., Kim, K.
TgSUB2 is a Toxoplasma gondii rhoptry organelle processing proteinase. (2003 Aug, Mol Microbiol) PubMed / full text
   more detail about this publication

rhoptry during extracellular tachyzoite
  • "Both antibodies specifically label over the elongated rhoptry organelles of the parasite."
  • Microscopy type: EM
  • Microscopy method: Monoclonal antibody directly to protein
  • Strain:
  • Gene model mapping comments: inferred from another publication
  • Localisation record: rhoptry during extracellular tachyzoite
  • Other genes localised in this publication: subtilisin-like protease TgSUB2

Bradley, P. J., Boothroyd, J. C.
The pro region of Toxoplasma ROP1 is a rhoptry-targeting signal. (2001 Sep, Int J Parasitol) PubMed / full text
   more detail about this publication

rhoptry during intracellular tachyzoite, parasitophorous vacuole during early tachyzoite invasion
  • "ROP1VSG is targeted to the rhoptries. "
  • Microscopy type: Light
  • Microscopy method: antibody directly to protein
  • Strain: 4R2?H
  • Gene model mapping comments: blast from M71274.1
  • Localisation record: rhoptry during intracellular tachyzoite, PV during early stages of tachyzoite invasion
  • Other genes localised in this publication: -

Hakansson, S., Charron, A. J., Sibley, L. D.
Toxoplasma evacuoles: a two-step process of secretion and fusion forms the parasitophorous vacuole. (2001 Jun 15, EMBO J) PubMed / full text
   more detail about this publication

evacuole and parasitophorous vacuole during tachyzoite invasion
  • "ROP proteins were discharged both into the forming parasitophorous vacuole and into numerous small, satellite vesicles that often extended in clusters out away from the vacuole (Figure 1A)."
  • Microscopy type: Light, EM
  • Microscopy method: Monoclonal antibody directly to protein
  • Strain: RH
  • Gene model mapping comments: inferred from another publication
  • Localisation record: PV and evacuole during tachyzoite invasion
  • Other genes localised in this publication: Rhoptry kinase family protein ROP2A (incomplete catalytic triad), dense granule protein 1 / major antigenp24

Striepen, B., Soldati, D., Garcia-Reguet, N., Dubremetz, J. F., Roos, D. S.
Targeting of soluble proteins to the rhoptries and micronemes in Toxoplasma gondii. (2001 Mar, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

rhoptry during tachyzoite, parasitophorous vacuole membrane during after tachyzoite invasion
  • "The propeptide and a central 146 amino acid region of ROP1 are sufficient to target GFP to the rhoptries."
  • Microscopy type: Light
  • Microscopy method: GFP tag
  • Strain: RH
  • Gene model mapping comments: inferred from another publication
  • Localisation record: rhoptries during tachyzoite, PVM during after tachyzoite invasion
  • Other genes localised in this publication: microneme protein MIC3

Rabenau, K. E., Sohrabi, A., Tripathy, A., Reitter, C., Ajioka, J. W., Tomley, F. M., Carruthers, V. B.
TgM2AP participates in Toxoplasma gondii invasion of host cells and is tightly associated with the adhesive protein TgMIC2. (2001 Aug, Mol Microbiol) PubMed / full text
   more detail about this publication

parasitophorous vacuole during tachyzoite invasion
  • "The upper row shows that TgM2AP (green) was mobilized from the micronemes to the parasite apical surface during attachment to a target cell. A small nascent parasitophorous vacuole was visible by staining with ROP1"
  • Microscopy type: Light
  • Microscopy method: Monoclonal antibody directly to protein
  • Strain: 2F
  • Gene model mapping comments: inferred from another publication
  • Localisation record: PV during tachyzoite invasion
  • Other genes localised in this publication: MIC2-associated protein M2AP

Donahue, C. G., Carruthers, V. B., Gilk, S. D., Ward, G. E.
The Toxoplasma homolog of Plasmodium apical membrane antigen-1 (AMA-1) is a microneme protein secreted in response to elevated intracellular calcium levels. (2000 Nov, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

rhoptry
  • "To localize TgAMA-1 in T. gondii, dual label immunofluorescence microscopy was performed on free tachyzoites using MAb B3.90 and antibodies against known microneme (MIC2), rhoptry (ROP1), or dense granule (GRA8) antigens."
  • Microscopy type: Light
  • Microscopy method: Monoclonal antibody directly to protein
  • Strain: RH
  • Gene model mapping comments: inferred from another publication
  • Localisation record: rhoptries
  • Other genes localised in this publication: apical membrane antigen 1, putative, dense granule protein GRA8, microneme protein 2

Saffer, L. D., Mercereau-Puijalon, O., Dubremetz, J. F., Schwartzman, J. D.
Localization of a Toxoplasma gondii rhoptry protein by immunoelectron microscopy during and after host cell penetration. (1992 Jul-Aug, J Protozool) PubMed / full text
   more detail about this publication

parasitophorous vacuole membrane and rhoptry
  • "At all stages of parasite growth ROP1 was found within the body but rarely within the peduncle of rhoptries, even in those that appeared empty. Immediately after host cell invasion ROP1 was associated with the parasitophorous vacuole membrane."
  • Microscopy type: EM
  • Microscopy method: Monoclonal antibody directly to protein
  • Strain:
  • Gene model mapping comments: inferred from another publication
  • Localisation record: rhoptry and PVM
  • Comment: UniMelb and UQ don't have access
  • Comment: no strain information in abstract
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_83944

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>TGME49_109590 rhoptry protein, putative
MACRQLLCSVQNLLFYFLPDIYCTDFDTMEQRLPIILLVLSVFFSSTPSAALSSHNGVPAYPSYAQASLSSNGEPRHRGI
RGSFLMPVKPHANADDFASDDNYETLPSFVEAPVRDPRQVPGRGEAALGTEETPGQQPPVALGSAEGEGTSTNESASENS
EDDTFHDALQELPEDGLEVPPPNAQELPPPNSQELPPPNSQELPPPNSQELPPPNAQELLPPTEQDLPPPTEQELPPPVG
EGQGLQVPGEHGPQGPPDDDQQLLLEPTEEQQEGPQEPLPPPPPPTQGEQPEGQQPQGPVRQNFFRRALGAARSRFGGAR
RHVSGVFRRVRGGLNRIVGGVRSGFRRAREGVVGGVRRLTSAASQGLRRAGEGLRRGFTRVRGALRGRGRAADGASSVRE
RFGAASGRVRDAFSAGLTRLRRRGRTSGEEGRPLLGEGREQDDGSQ

Gene-Specific Links for TGME49_109590

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins