ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_109410 (AP2XI-1)

hypothetical protein, a gene from Toxoplasma gondii

Compiled localisation
nucleus during mitosis of intracellular tachyzoite

Who localised this protein by microscopy?

Behnke, M. S., Wootton, J. C., Lehmann, M. M., Radke, J. B., Lucas, O., Nawas, J., Sibley, L. D., White, M. W.
Coordinated progression through two subtranscriptomes underlies the tachyzoite cycle of Toxoplasma gondii. (2010, PLoS One) PubMed / full text
   more detail about this publication

nucleus during mitosis of intracellular tachyzoite

Orthology

OrthoMCL

Part of OrthoMCL group OG4_115799

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>TGME49_109410 hypothetical protein
MTQEEPRLTGQLHTPIRGPIQPPEIEEMENAVTPKCADVAPAAAASHSSHSSASTVGDLSDGSSDPDSQPSRGDVRDEEL
AKAAVFDALTPKHSPEPRAVAAELHTAPVVGPDDTSRPIALFHPDGPEENAWKADGETATIHGGEASQEEGADSSSEDLR
QDQRTQGRPVASPLPSSFEHASSFLRLVSSAIGAPQAGSSLSRLGIPVRSETASQLAAGSTTLASFAPPGKTKFDAARSD
DDRESSWIFSSPTSSGRNAGASPLLSLSGRAPFQRGLSSHSESPYPAFLPKAASARSSTSCESQFLSVPNAERDCVQHSP
SVSPPPSTDHATVFEGDGGDASKTQQLTPSKPCKLPAEYEAVALLLRARQEAKNEGDESPRNRFAGEADAMIAAWLRNLS
NEDFDVLLRYIRRVTGAKRSESSAFAPARTARVSGASSSLGVPAQAVSAISQASPEFRGVTPSQGYPRKPEKSQSPPSHF
LLSGCEPSDNPKTDVAGLERHLRTALQCAGASSGTPENCMLPVLASVREEIRGMPSEKETRARFVEDLYEVRRNAFHRQE
AARYGGYVSCLACGCTVCGCSKFGEGQPSWISTLLLTAPSSSWTCARAMEREFDRKNAERAAAAATAKAARGGRFPKKAE
KGPCHVYNTRCSSAASIGNVTPSTATGNGKGTMLSEAPAEGATGKTAGSWAGWNGWARRPETPKKRRVKESLESGIRFAN
ALSQVEEESEDEPNPSAKDTSVYTLPALESGNAPRDGRASAASSKRKHTFLEPAALPCFSVKRMRHAELQGEILEEGAGK
LDGCDSGKEKGIASRTRTAKKPLRLSVSSKLPYLRSGAEHSGHELFRSRAKPDGELSCEVNAARRGKRSCSSEVHNHGGQ
STRPRTSSVRDGKIPSLGVSGTDLAQQPPAKALGHQEKTPHSETIDSNKGTTAKESKRVSTAKAGTAKGAFPQRRQFRIH
HMIPEPEVKEGLLFNPTPAHFNKYPKARGVWFDPHRNLVRTCWKENGKAKTVGFPVAKFGLDEARFLAVQLHQFKCPEDP
VPSDLQGKLPAVPRQEFEWC

Gene-Specific Links for TGME49_109410

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins