ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_109250 (AT-hook 056400)

AT hook motif-containing protein, a gene from Toxoplasma gondii

Compiled localisation
nucleus

Who localised this protein by microscopy?

Dixon, S. E., Bhatti, M. M., Uversky, V. N., Dunker, A. K., Sullivan, W. J. Jr
Regions of intrinsic disorder help identify a novel nuclear localization signal in Toxoplasma gondii histone acetyltransferase TgGCN5-B. (2011 Feb, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

nucleus
  • "IFA with anti-HA confirms that the native AT-hook 056400 protein is located in the nucleus (Fig. 3C)."
  • Microscopy type: fixed light
  • Microscopy method: HA tag
  • Strain:
  • Gene model mapping comments: Taken directly from publication
  • Localisation record: Nucleus
  • Comment: strain information not found
  • Comment: stage information not found
  • Other genes localised in this publication: histone acetyltransferase GCN5, putative

Orthology

OrthoMCL

Part of OrthoMCL group OG4_115797

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>TGME49_109250 AT hook motif-containing protein
MRRLSISAGTPSTKGGGKACVVSASDVPPSLSRASESHLPRPREEPAQAIPAALPFSPASSLPASPGSGGSGVCTPDSRG
QAGAAGGPQGGRRGRKSVQTVKAGQSPAPLVAGSPRGDRLPCQKEEGSVSEQKDLLSVSRCSASPAGPPSVGAEAPLSSL
SRSRRPSVADARSPLLAASAAVPSATSALRPSRAETVSLTGASPPPAVVEPQPAGDGIAEKASSGRTGSSEEDQDAPGVF
SQRASRSKEDGRDVALLGGQDERREELREERGRGRRQGSVAESRLQAPASKTEREGKKAEADKKEETGKSTGRQRLPPSR
CRHRVEEPRWDEEDESELSEYAGSASGVNAGFPGAEKLEKECVRSREEKRRRRDEKGNETGSPQPERGGEEDARGAMRHG
EAGKDPAADASGDAREGAPLPEQADSEKEGAEKKARQQPGRTEESRGKRENARGEEEQEEAEKKRGKKEDLRKKKVSSVR
RPDEEKEETEVDVVMTDANEAEREAVHAERRESAESGEGAEAREEKKRRVEGREPAKLEEAMGEAREAQSDGRREEDGRG
SSPGEAEGPEGLDRDSHGVCRGNLGGDRGRNSHAEKETSESLLGETAKAAKQLEEREGGRGSEVQQENETEKGERRRGLK
SDGRSKTGLGRDADHGKATRRSEKPPEESRQQTSASPSSTSSSSSAAVVGTESDACDASAEKKERGGSPGRAALAAPAAD
SLQVCDADPASACVGTLKRTGECSAEGDEVAAVQSHGKARLGEKREIPQGAVAGLDSERRRKGERKEARESSLSVSGSRK
IQDAYLSEVAAEDADPGDRLAASEVKSSASSEAPASPGTAREDGASRLAATSPSRSQGGGASTVATRSSSRIAAKTQVPE
PASRREEREERRQREDKLWERVHRRRDSEKEEKGGEIRYEREEKSGEETEANTEDAKKGGERSSTSPESELLPSRQKSSS
DFKGPVKGSRRGPVTLFSEPSAPPANDEPSDAGGATPSSEAKLGTGRPKRSASAKAFSAEKVNRSRKAASEKEDSGVHTP
QNSSDASRPRAESATEAAPRGPEGPGTSDDPAAGVVVSGSDDRAAGSASKQRPLDLMSPTRSAASPLERPSAPVSPVAEA
VSSASPLASQREAAPARRSARQQQRQAALATSLSRCLEGDGAEYVEAQPRSSKEGQDSLKDIAPRVADAAASSPDSTEET
PGSDASATSADPSGGAAESGRRGGRGGSGSGASSGCGAAVETRRSLLGLTITNSPYWSRPSTHGSAAGGSSASARGSNGD
AAKAGKEGRDSETQAKSAGSSLAVRPRLRPGKASNSASGPAGDAGASGTLPSRRGPGAAASPSERACEKKAENRESGEEH
RESGERERELKREASDEMAKNGGCRREDVRKARRGEEEKRGKADERERRKAEEDLEKESRERGAKKAGHGSGSGTRSGLL
PRLRTRGFGREEQGENTDGENEDAGLSGTQRRDFLPTRGTQSAKRSRRAAEAMAAVAAGAAAAARERRRQGSTRHLGDQR
EEEGGEEREEEGEEDRISFFRHEGASSPESRQESAALLGFSSTSISRDTSPEKDDGGLRSRRLSVSSLQREEEKTRGEAR
ETRASKARRSAVARDEAEKREGESEKKEETQVTEESQKDEGKEDLKELERRRRRLTRGREEENEWPKFGRGRTRRASLLS
SASLSRHGNGSRAAAAGGDEQEAYEELRQKSREEEKEMKEATEKDKGEAGGETEEHGELSSSPVAVAPRSTRGFTCVKRQ
SPSLGEASRLLDSTEGEEKREGEEKKGEESGSEGPSVSPSHGVRAASRQSKHEASRESGDFEQDEKKGEEADPDPGDAAS
AEERGRGEGGLNREGDREGDEGEGGEEIEKKEEKSLAGTEERETETGEGRDDASAPSADRDRHSQEDRHEKRKAKETSAD
RPADGEEKDSVADGVVRRTGTRLSAARQMTPKNEEGESAGAKKDGKQAEEGGGEVTAFKAVIAKLVAFNEADKVRYPQWY
TGPVGAFEPRHNQLCWWRFRVQAKYQPGRVVMDFNEEIRCGRLTEAVKQQLFVTCVRRTHGTGSAQHLVCRSNTDETGGP
AEPPHIGDIVIVQNLEDLKFSVCNWKVTKPLPFPAGEMQVRLERASGSALGVLNSLTRAKKFLQIREKYSGLQFGSVESL
EKQLLDILAREHLKPTLEIVAHLQQVDVGHVLQTYTSMPPGWDWTAFQKEQDRLVAQRRRGKADASAALEDESAPSETSG
STGRLGQAPASPPFGSSSPFSSSACTARSSGAKAGASGREDAAFSGASSLRSAVGDTPTMSTSTFSAPSASPRRVVYATL
PPHIAAARARVTLGAGGAGPSLQAIPVLSSLTQSLASSSLLDDDSLSLLADLPPSHPLFLNLLNQSREPPTPRADAVVGA
LPGLSGQWIRMLSQLILRRDALLHLLQPVSLDLLHNPTRVFGPLPALLPPDLLLQVSLATGDAGPACHLLTANLYLARLA
DNAAVRTLDPAQKRIRVLQSSRAETADRSSFAERLLGARDEKRARKWSAERHTDAEKPHRPKKKRRRDPNEPPRRRGRPP
NRLRFASGDVSSFAARETSAGPQSSSAPKGPSSSSLTSSSLSSSSWSSSSSSSSSSSAACAASLRRSLLLPASSSSQSEN
APPVSYEMGHSITFSVGLTYGRLFLPSLISELSPNKRRSVHGRCSDDEVSETELLETLDRRSRAKRLFDRQITCAPWIGC
CPSQSAELAAALALGTAKTEPSSSSLSSSSDLLASSAVSHGEKWTTERQERTLEAARPAGEETPSAGEKEDAREMGGDTN
ETAFREAASLERDAPGEREAVVREEQKTEEEQAKESVAKEDKKLNQSRHANSGDAPPSSLETSSLDRCFLREVSASFPAR
ESVSDKSRNGEHEGEKRCRKELGTVRVKKQMTLWSSWGLAKKREDPPEKSSQLTSLSKPRQEPSKSIPGDDKQEANRASS
QRSSLSARGLGDQVSLDSGAQQSRLRATLRVGDEKAVDEERETSANVEAGEGEAASGHKVGKPEGTKTDGIRGDNPGDER
RAGEEAGSWNSNLIFFSPLSVCSQADGEEQIEEESRYSSCLAGESCANVEQERVKGERGDAESARHSPGQAKRARDMPEG
DRQHEGEQKKFLDCVPLAAAEASGVWSDIAGKTQKTPASEAPRGRPDEKTGDAEETRRVAACFSSSPLCRAEHELFSEGE
SELQAAMRLSVSDFEEEEEGDILRKEEREVPGVACDPARPSASCAAASSPAAKEREDEGRSGVSEAARTADKRLERPGES
TERTQGRERERSTGSGGDVAAEEGDEWDPRPPLSLARSAGLKEEKSRDRDQRERTEERREGKYAREGDETHRKRQTRRDS
GRELEMPNASREPRFPFCTPGPYESVNLNLLCLHNSCDDEDFLLRVALEKVSSKPPPLDELERCFTTHGERFDLHWLDRR
LANTQKLQKLQPELVRLLTSYRTRMATASRLAASSSSAPPAPSASASSSPSSASASRSASFSGSSRSTSSVAPAPRASSS
FSVARLAEGLGAREKSFQTLKEKQEAGAVLLRQALRLFAKEKEHLLQKRAKCREKREKDGPPLSSWLPAVETLRTKKRSD
DAALLPRLQPSYDWQVEALAALPNRSLPADNEARKGEREDARKDEQKEKEIPVEFEALFNTLRILAKQKVSSTLPSSSSS
LSSSLSSSLPSPRSSSLSGVRCAGSGASGGEGREGRAGDEKGDKGAVSPDSVEGNACEDPEKREREEERSVREALLQEEL
KEIEEWRQIFVELLSMQPGTPKNPHVLRGPVDGFAVPARG

Gene-Specific Links for TGME49_109250

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins