ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_109140 (TBL1)

transducin beta-like protein 1 (TgTBL1), a gene from Toxoplasma gondii

Compiled localisation
not nucleolus and nucleus during tachyzoite

Who localised this protein by microscopy?

Saksouk, N., Bhatti, M. M., Kieffer, S., Smith, A. T., Musset, K., Garin, J., Sullivan, W. J. Jr, Cesbron-Delauw, M. F., Hakimi, M. A.
Histone-modifying complexes regulate gene expression pertinent to the differentiation of the protozoan parasite Toxoplasma gondii. (2005 Dec, Mol Cell Biol) PubMed / full text
   more detail about this publication

nucleus and not nucleolus during tachyzoite
  • "This protein ectopically expressed in tachyzoites localizes exclusively in the nucleus and is also excluded from the nucleolus, as observed previously for TgHDAC3"
  • Microscopy type: Light
  • Microscopy method: HA tag
  • Strain: RH
  • Gene model mapping comments: blast from DQ004746.1, annotation matches
  • Localisation record: nucleus and not nucleolus during tachyzoite
  • Other genes localised in this publication: histone deacetylase, putative, histone H3, arginine methyltransferase protein, putative

Orthology

OrthoMCL

Part of OrthoMCL group OG4_12285

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_109140 transducin beta-like protein 1 (TgTBL1)
MRIHLSSDEVNLLVHRYLLENGFLHSAFAFSAEAAISKNPFHATHAEKLPPNALVTLLQKALLFIYVEFHTEDETGRAIP
CDEVFSFFKRHECWTRREGSEDVASASGLLASLAEGAATPRYAPAAASPSHLVKNSEGGGPESASNDLDFLAGSILADDE
RAERVERPSAVRGKRGAGGCGATGAWNRGGGPRGKKRARIQYRGAAGPGVDLPDALAGSSHNAGSSPVEEEDRKEAAQEA
EAGVLSGRREDEEESEDAPPGALARAAPGEDIIYEGPPAHACEEKVALKNFLRLLPGHDGDAGALSEWSPADPCLIVTNF
AAGVPWLYRLPSVEIVGPGVLAPFRELEGPCVGGALNPGSSAHWKRDGELVATGYESGDVRVWRPLETSCVASLSVSSTS
VICTAFSCEGTYLAAACADGSVVVWQLRRDKTAECGEKVGAGREKDRSAAADSKSEETNGGGRDSEASNSAISFVKVHAY
RHRGGVIDLDWTRDSVIASGSVDGCVVVSDLPKRVCHWVSLGAVSPRAGTATLRVFVENAAADANREQEKVETAAGEDSP
TAPKARREEKRDKDDGADPMGELPVFPEQPAEEQSDEKGEDARKADGLKAADAVEGSDAEVASLRWNGDGTFLAIVDSSP
VVKLWQLDDPPAPLIELAAHAEPVIKAEWRNGGRDDNERFLVTAAMDRQLFLWDLEKSRTEPAKTIVYKYPPTSLRISGD
GSRLAVGTYDSVVHIYALPSLTEVASLIDPHMVIPHITWRSTHDSIAYNVFNMGRTIVAKAEEKPGAAKLEDSA

Gene-Specific Links for TGME49_109140

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins