ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_108840 (SRS3) *

* The amino acid sequence is recorded as differing between ApiLoc and the genome database. See the gene model mapping comments in each localisation for more information.

SRS51 (= SRS3), a gene from Toxoplasma gondii

Compiled localisation
host cell plasma membrane and parasite plasma membrane during tachyzoite

Who localised this protein by microscopy?

Saeij, J. P., Arrizabalaga, G., Boothroyd, J. C.
A cluster of four surface antigen genes specifically expressed in bradyzoites, SAG2CDXY, plays an important role in Toxoplasma gondii persistence. (2008 Jun, Infect Immun) PubMed / full text
   more detail about this publication

host cell plasma membrane during tachyzoite

Manger, I. D., Hehl, A. B., Boothroyd, J. C.
The surface of Toxoplasma tachyzoites is dominated by a family of glycosylphosphatidylinositol-anchored antigens related to SAG1. (1998 May, Infect Immun) PubMed / full text
   more detail about this publication

parasite plasma membrane during tachyzoite
  • "The products of two of these new genes (SRS2 and SRS3) are shown to be expressed on the surface of Toxoplasma tachyzoites by immunofluorescence."
  • Microscopy type: Light
  • Microscopy method: MBP tag
  • Strain: RH
  • Gene model mapping comments: Blast from AF012275, annotation doesn't match? gene model inconsistent at 5' end?
  • Localisation record: surface during tachyzoite
  • Other genes localised in this publication: SRS29C (= SRS2, P35)

Orthology

OrthoMCL

Part of OrthoMCL group OG4_115784

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>TGME49_108840 SRS51 (= SRS3)
MAVPREISWTQSQREMRLQIPYGRLLTRQSTLFFVALLAVVLHDSFVAFHGHLCHFAEAAAHQGSCTSQGTSSPMQVCTC
NVPEQGETSNHAVVVSAEKNQLMAKCAIGTVTLPVDLMEKQVVCPAGMTDPQSCVSPSGTIPFASLLSGDGASAVAWVGD
EVNYAAVLQVPKQNLPPVDKEFIVGCTQEGKGHCLLHVTLSARASSKDSQTVTCAYGSASNADVHRVTVSPKDPTFTLDC
SSDGIMQPASFTTSYCPATGPLQENCDEKYASILQGYSSSWWQVSQAGTSNKAVLTIPHDNFPEAQKKVLVGCKASTAIP
NSTLCTVELTITSSSPSSAWFLSLSVTMTLAVAGAVSSLV

Gene-Specific Links for TGME49_108840

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins