ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_108080 (ROP5)

Rhoptry kinase family protein ROP5 (incomplete catalytic triad), a gene from Toxoplasma gondii

Compiled localisation
rhoptry during intracellular tachyzoite and tachyzoite

Who localised this protein by microscopy?

Agop-Nersesian, C., Naissant, B., Ben Rached, F., Rauch, M., Kretzschmar, A., Thiberge, S., Menard, R., Ferguson, D. J., Meissner, M., Langsley, G.
Rab11A-controlled assembly of the inner membrane complex is required for completion of apicomplexan cytokinesis. (2009 Jan, PLoS Pathog) PubMed / full text
   more detail about this publication

rhoptry during intracellular tachyzoite

Bradley, P. J., Ward, C., Cheng, S. J., Alexander, D. L., Coller, S., Coombs, G. H., Dunn, J. D., Ferguson, D. J., Sanderson, S. J., Wastling, J. M., Boothroyd, J. C.
Proteomic analysis of rhoptry organelles reveals many novel constituents for host-parasite interactions in Toxoplasma gondii. (2005 Oct 7, J Biol Chem) PubMed / full text
   more detail about this publication

rhoptry during tachyzoite

Orthology

OrthoMCL

Part of OrthoMCL group OG4_83955

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>TGME49_108080 Rhoptry kinase family protein ROP5 (incomplete catalytic triad)
MATKLARLATWLVLVGCLLWRAGAVQLSPPNSRTNDLASGTPHVARGDTEAQSGTGDDSDFPQGVVEEVADMSGGRVPRV
PASSTTTSASEGIFRRLVRRLRRGRGTADGAGVADETHQGPRPPLRKRLAQHFRRLRGFFGRLTPRWLSGLGRRAQRWWR
GRQRPLLDPSFHGLEAGDSFMRDLLKHEKELIGYCREEALKEPAAMVEAVMATVWPQNAETTVDSLLSQGERKLKLVEPL
RVGDRSVVFLVRDVERLEYFALKVFTMGAENSRSELERLHEATFAAARLLGESPEEARDRRRLLLPSDAVAVQSQPPFAQ
LSPGQSDYAVANYFLLMPAASVDLELLFRTLDFVYVFRGEEGILARHLLTAQLIRLAANLQSKGLVHGRFTPDNLFLMGY
GPVMLGDASALWKVGTRGPASSVPVTYAPREFLNANTATFTHALNAWQLGLSIYRVWCLVLPFGLVTPGIKRTWKRPSLR
VPGTDSLLFDSCIPVPDFVQTLTRRFLNFDRRRRLLPLEAMETPEFLQLQNEISSSLSTGQPTAAPSVA

Gene-Specific Links for TGME49_108080

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins