ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_108020 (SAG3, P43)

SRS57 (= SAG3, P43), a gene from Toxoplasma gondii

Compiled localisation
host cell plasma membrane during tachyzoite

Who localised this protein by microscopy?

Saeij, J. P., Arrizabalaga, G., Boothroyd, J. C.
A cluster of four surface antigen genes specifically expressed in bradyzoites, SAG2CDXY, plays an important role in Toxoplasma gondii persistence. (2008 Jun, Infect Immun) PubMed / full text
   more detail about this publication

host cell plasma membrane during tachyzoite

Orthology

OrthoMCL

Part of OrthoMCL group OG4_116037

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • NCLIV_060660 SRS domain-containing protein,SRS57, putative
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>TGME49_108020 SRS57 (= SAG3, P43)
MQLWRRRAAGPASLGRQSLPLGCFFAAFGLCVLSAILGTGERGLFVAAGNSRRKITYFGTLTQKAPNWYRCSSTRAKEEV
VGHVTLNKEHPDMTIECVDDGLGGEFLPLEGARSSYPRVCHIDAKDQDDCERNRGFLTDYIPGAKQYWYKIEKVEQNGEQ
SVLYKFTVPWILLPPAKQRYKVGCRYPNHEYCFVEVTVEPTPPMVEGKRVTCGYSESGPVNLEVDLSKNANFIEIRCGEQ
HHPQPSTYTLQYCSGDSVDPQKCSPQSLTNIFYDYSSSWWKGKLNGPDGATLTIPPGGFPEEDKSFLVGCSLTVDGPPFC
NVKVRVAGNPRKWERGGGGHPGSGGLQPGTDGETQAGTGSSAGASSRMASVALAFLLGLLVHVAA

Gene-Specific Links for TGME49_108020

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins