ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_106960 ()

phenylalanyl-tRNA synthetase beta chain, putative, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10936

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • PF11_0051 phenylalanyl-tRNA synthetase beta chain, putative
  • PBANKA_094290 phenylalanyl-tRNA synthetase beta chain, putative
  • PY02380 phenylalanyl-tRNA synthetase subunit
  • PY02381 Phe-RNA synthetase-related
  • PVX_090880 phenylalanyl-tRNA synthetase beta chain, putative
  • PCHAS_090140 phenylalanyl-tRNA synthetase beta chain, putative
  • PKH_090120 phenylalanine tRNA-ligase, putative
  • TGME49_106960 phenylalanyl-tRNA synthetase beta chain, putative
  • NCLIV_053190 hypothetical protein
  • cgd8_3320 phenylalanyl-tRNA synthetase beta chain
  • Chro.80385 phenylalanyl-tRNA synthetase beta-subunit; PheHB -related
  • CMU_023880 phenylalanyl-tRNA synthetase, beta subunit family protein
  • TA11150 phenylalanyl-tRNA synthetase, putative
  • BBOV_III009590 phenylalanyl-tRNA synthetase, beta subunit family protein
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_106960 phenylalanyl-tRNA synthetase beta chain, putative
MPTVSVPRDELFRRLGRTYSVHEFEELCFEFGIELDEVVEPGKDGSTETIYKIEVPANRYDLLCTEGISRALYAFNNPDA
PLPAYRLEPATPQFTMTVKPAVNQVRPFVVCAILRNVTLTKAGLASFIEFQDKLHHTLCRRRSLVAIGTHDLSKIQPPFV
YDARPPKNFEFVPLGCDSQMNGEQVMAHFSSHLQLKAYLPLIQNSPVYPLILDAKDRILSLPPIINSEFSKVTEDTRDIF
IECTAVDITKAQIVLNTLVAMFSEYCKEPYTVEPIRVVYEDPSSAPIDRSVKCQGEASLQNGSASMNGWVFPRVNSRSMP
FSLDYVRQLTGIPDLTADACANLLKRMMIHTSIEKATQAGILEASIPITRSDILHERDIVEDVAIAYSFNRLPVTRSYML
TGDALNCLSEKIRNFCTVCGYTEALNFSLSSAAENSSSLGRTPGDGKSSLFNPLEYQVNAQPVRLANSKTREFDQVRTTL
ISGLLKTIVANKGRRELPIKLFEIGDVCLLDSTTEVGARNLRYCCLAFADEHSSGLEEVHGVLDALLQSLQFVGEYAIAE
MEAAVAAAAAAEKAGCEHASAHATEQLQRTLSRIRGTFKLVPSHEETFLPGRQVQVVASLKSSGDMENVPVLLGVMGTLH
PHTLKAFGLTIPVSIFELNVEAFVQWLPAIDLVVG

Gene-Specific Links for TGME49_106960

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins