ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_106930 ()

proteasome subunit beta type 7, putative, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_11134

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • PF13_0156 proteasome subunit beta type 7 precursor, putative
  • PBANKA_134330 proteasome subunit beta type 7 precursor, putative
  • PY04957 proteasome subunit, beta type, 7
  • PVX_082355 20S proteasome beta subunit, putative
  • PCHAS_134790 proteasome subunit beta type 7 precursor, putative
  • PKH_122490 proteasome subunit beta type 7 precursor, putative
  • TGME49_106930 proteasome subunit beta type 7, putative
  • NCLIV_053220 PsmB (EC 3.4.25.1), related
  • cgd3_2530 PUP1/proteasome subunit beta type 7, NTN hydrolase fold
  • Chro.30293 proteasome component precursor
  • CMU_000900 proteasome subunit beta type 7-B precursor, putative
  • TP01_0908 proteasome subunit beta type 7 precursor, putative
  • TA06335 proteasome subunit beta 7, putative
  • BBOV_IV008660 proteasome subunit beta 7, putative
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_106930 proteasome subunit beta type 7, putative
MPFPPFLVTSTCPIDPFRSSAPVCLPVFRVSAPCLLLASRTSKTLHSLPVPTVCVGLSVAVRSRSRCSAPDLPFYRFLRA
STMDSISQLALQRGGYDFSNHQRNVRLLMEAAKRCPAVAGSPTPPGLPPARKTGTTICGVVCKDGVVLGADTRATEGTIV
ADKNCSKLHRIADNMYAAGAGTSADLDHMCDWLAVQVELHRLNTNAKPRVSMAVSVLSQELFKYQGYKGCAVVLGGVDFK
GPQIYKIHPHGSTDCSNFAAMGSGSLNAMAVLEAGYKDGMTLEEGKNLVRDAIKAGVLNDLGSGGNIDLCIITREGAQHL
RKFETPTQRPFQATHPVFPKGTTPVLLEKIEQLKSRLEFSQEVEMVEA

Gene-Specific Links for TGME49_106930

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins