ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_106060 (RON8) *

* The amino acid sequence is recorded as differing between ApiLoc and the genome database. See the gene model mapping comments in each localisation for more information.

hypothetical protein, a gene from Toxoplasma gondii

Compiled localisation
apicoplast during intracellular tachyzoite
rhoptry neck during intracellular tachyzoite and tachyzoite invasion
cytoplasmic face of the host plasma membrane at moving junction during intracellular tachyzoite and tachyzoite invasion
cytosolic side of host cell membrane during tachyzoite
moving junction during tachyzoite invasion

Who localised this protein by microscopy?

Straub, K. W., Peng, E. D., Hajagos, B. E., Tyler, J. S., Bradley, P. J.
The moving junction protein RON8 facilitates firm attachment and host cell invasion in Toxoplasma gondii. (2011 Mar, PLoS Pathog) PubMed / full text
   more detail about this publication

moving junction during tachyzoite invasion
  • "R8c parasites demonstrate restored RON8 expression in the rhoptry necks of intracellular parasites (as shown by colocalization with RON4 by IFA, top panel) and restored RON8 traffic to the moving junction during invasion (arrowhead, bottom panel)."
  • Microscopy type: fixed light
  • Microscopy method: 3HA tag
  • Strain: RH ku80- hpt-
  • Gene model mapping comments: inferred from another publication
  • Localisation record: moving junction during tachyzoite invasion
  • Other genes localised in this publication: hypothetical protein, hypothetical protein

Straub, K. W., Cheng, S. J., Sohn, C. S., Bradley, P. J.
Novel components of the Apicomplexan moving junction reveal conserved and coccidia-restricted elements. (2009 Apr, Cell Microbiol) PubMed / full text
   more detail about this publication

cytoplasmic face of the host plasma membrane at moving junction and rhoptry neck during intracellular tachyzoite and tachyzoite invasion
  • "anti-541.m00141 stains both the rhoptry necks and the MJ of invading parasites as assessed by RON4 colocalization."
  • Microscopy type: Light
  • Microscopy method: antibody against His6 tagged protein
  • Strain: RHΔhpt
  • Gene model mapping comments: taken directly from 19134112
  • Localisation record: rhoptry neck and cytoplasmic face of the host plasma membrane at moving junction during intracellular tachyzoite and invading tachyzoite
  • Other genes localised in this publication: hypothetical protein, hypothetical protein, conserved

Besteiro, S., Michelin, A., Poncet, J., Dubremetz, J. F., Lebrun, M.
Export of a Toxoplasma gondii rhoptry neck protein complex at the host cell membrane to form the moving junction during invasion. (2009 Feb, PLoS Pathog) PubMed / full text
   more detail about this publication

rhoptry neck during intracellular tachyzoite, cytosolic side of host cell membrane during tachyzoite
  • "RON2, RON4, RON5, and RON8 are all present at the MJ during invasion... we demonstrate that RONs are exported to the host cell membrane, RON/4/5/8 being exposed to the host cell cytosol and RON2 being probably an integral membrane protein that displays a privileged interaction with AMA1."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: RH HXGPRT–
  • Gene model mapping comments: Blast from ACK57540.1, gene model inconsistent
  • Localisation record: rhoptry neck during intracellular tachyzoite, cytosolic side of host cell membrane during tachyzoite
  • Other genes localised in this publication: rhoptry neck protein 2, hypothetical protein, hypothetical protein, SRS29B (= SAG1, P30), dense granule protein 5 precursor

Bradley, P. J., Ward, C., Cheng, S. J., Alexander, D. L., Coller, S., Coombs, G. H., Dunn, J. D., Ferguson, D. J., Sanderson, S. J., Wastling, J. M., Boothroyd, J. C.
Proteomic analysis of rhoptry organelles reveals many novel constituents for host-parasite interactions in Toxoplasma gondii. (2005 Oct 7, J Biol Chem) PubMed / full text
   more detail about this publication

apicoplast during intracellular tachyzoite

Orthology

OrthoMCL

Part of OrthoMCL group OG4_83968

Localised Genes in this Group
Other Apicomplexan Genes in this Group
    There are no other apicomplexan genes.
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>TGME49_106060 hypothetical protein
MVATTLHSLPSRYLYTLLMSFLFVCGALALHESPDGLPEAPDRPQNAESGDGPPTLVLTLDPEYAGKSEEFAFTAEYFPP
TESSKNEDGAQQSFVETPNRRLPGTFDPMSSSDVRSEVQLRVTTQQMERGLLAEIVVLQEGQMVSGFRASLQTKEQAALL
HRLADLTNDPNIHFRVEWRGRGDGTGGLYIRTAVHLLATAYKPSVHFKLNLHQTGARGARETIKLLSSVPIDDLNAPGVD
IGTLKQLIVDHAEPENILTGPGSFSIKRMFKESDPKNANTQEATLVPWLLRLLDLASPVTIVGDLTRNREFSTVLPQGPA
NWNDLLLLYTGMGDAANRGQNAPDFAQREPGYRPGSIFLSPDGFRGAAHLGDHQPDRLKQFWRQGGETGLNPGDIEHYYS
PLFGRSYDTSNNPLLILDMYGNPVYSEGGVPKFIVGPGENDLTKLPDHVSGMVLPSVSARFLFPDKRSFTEFINPARPWN
DISKGWKALMAKHKMKFNYREPGLVGVSVNGNWYGLTSEFIQTYPTLLHLLGSLAQSTPGFSLEDVTLHFDDKLPPKLPT
LFVLDDAHDRQIPWCAFEFVIPLSPRGTVNIKSLLAKGKSAAESPKGCNFREKGFHFTTVHRWGFVESRNPLSIQWHGVL
DYTGSKQECALLGNVLKDAHLAGRQIAVSFHAEHKATVIPVIETFGPDGELLKSKPQKPVTATVQFGDDLPGLLYDFHKP
FQKKKVPTVVYPFLQGQGQGSRDALNGGVLGEEYYHRPRKTKITMRPEIPILNTHDTFVDGSGPHPNVPHFVIPLTAGPQ
QHLAPLKALRQWLRKEYPGSQLPFKLDRMSDEDLLGIADHLVFRFPDGTEATLRSIFGPEVFSPNWATMNPDAYQKLMDV
LTRPKKVYLAKNFRIVVTDVDGQQIPFDIQIEPGDTWAKTLDDFFKAHPNLKPANVKLVLYDDKDTALRQFDINLDMYAS
PYTEAVDQQHMKGLQITLETPAPIVSCYQADPARPGQCLAVDMKRIFCGRVNPAKMVSRAWNEECTAAWIARADLGEVED
RYLMGPDDVRARSIRDLLTSAKNALKQRNPEKAKHLNIPVADVTESEELNRKMRERTELAMKSGKTLEDLDRLRHLKFEI
RTLQRQGELQWAKLVGATITTTEKGKPAERHIRLDPKKFFLNDKLWKVFKELAAQVPGLKFENVFNFSFEVMNKEAREQW
KKEQTTVTKEAKKQMRSQKTVVDVIFVGPDGSALFRDIGVELRQLSDEALGRLSKGDKRGLINQLAKRYDIPRQYFIRRG
GFPSAAVNGTKWVITAMLGLVGGAGKKGLASLLKDPHAFVTHLQSAGGFSPTDTVKLVFDNGSVLDVPLSQLPDQDLGSL
AEIYFPWKKTAGQAQEEKKKAVESKVAEGSGIMRKLEVTVMQPSLWPEVFGAWLSDLHEMDLFDDGPILLQVRPEGAQKG
QVIRCSVKTLGELYQALNKPEIIRSKCPGMADLKKPFTFELSIRTPAEQYYKLYNRSRSPEDQRRTAAVLLKLKDHIRNL
PDDGQVIFEYRKIKRTLTPQELQQLKALIEGLQPNENTDDVLTKILRLLGISDQDIAKSGRLRFGIKQAPTSSEQQMLRE
GSITAVVEDFQGGRRKATVRISIPEEEPLRLGASAQNYQVHMSLFSKNAQHLNTPCGSKSGAEVAKATWGQLCRWCNLKL
ADLPGLGHPTLYIRIISNEKTQTVRGGQPVTTNVDGHPVVYDIRMPGDPRSASGMPKSVFWNLVERPGSNELGPVWHQSI
PKADGGLRKDYSYFDPNPGAWDPTLFGPSSGTFPQNTRAGIDIVTNPEAMETGDAYAPPIRFGFGFRNWNDRDAVKPQFN
NMVSGIAPQERDLYKVYIQIPKGDGNYYPCSGVDINLFMQLTKEQIARACGIHPSLLEAPFGVYLLKETPTYARAQPSFP
LFFVDGEGQEHPSLGHWTDAPAKFFSPHLRGASPNSLIQLEFAPGVTCNLTQQELMSLHTWEALLKRCNIDAGKERPATI
TTRIVPMFSTPNVTVKVPNELLQPLLRQHRGISPDQLFRQKPLEEVVALLLSNAHLGLYHVGLKYIDGTDQPYSECPEHL
RQLPPSQIPGLQHIYIVVFRGGTLGDMMKGMNLSPQTTYGDFVRTVKKKINSPEGLTIPGVRQHVGGSGRPAQQIIDFDF
AGPESPPGAAGKPGWEATWRPATVGAFPDNMPIGDIDREMHHPFLVFLNGLAAYGGQPFREETTHLDASLRNLVEWMKDS
LGISDPNGILAEIVIDTIRCPFPLSAAQLISATIGHLLHHCQVNDLEMSHSIYVTPTPVPGYTATPKRNGPQIVINGHNY
GAPGTAPRDFGQLFNLPGRPGARPLNQDLEVSFSPLPGKPPVRGVLPGDVLPLLQSISDKHGQPGVAVVLNFLRQLHALA
ELPPGATLNIDTKLIPSQSPQQLYAPDQVPQPGPWIAGPTGGGRFPGGGVVVNESGGRRGPGGSAAVKFMPSTLRLPLLR
QPSVELPRNSMLRGSIGGVGGLPRTEFVVPILPSQKSMPIEQVLKFFGIAPAAVQTLDVQEKPEQGAILIESGTVTFVPL
KGPTFTVSMKKINATDKNTLATLLKAAGRSIIDLVGASDGTQPLVLKIVVDHGAVSPTKVTTPVGTPSHARSAMEGLTIW
NLLPPLIDVHSVKTITIRVQAAKAFQQAAKAAAAAEGTEGDSAGEPLSRPKNVEPAVRTKFKNKIPELPAAFKPRQRTVS
EINGAPNPKLVIFVEQDGQKTIRFTFPSRVNDVVIGQSTVSVVLDALLPNPGTWHRTFWGALSPDGTSCKPTMEFQYPHW
LQTKMAELPVPNHSSCLLIREVSLNIKQRPNFFIKPYIFHSPLVIFALQGKQRIPIFEEQVDPAVTSQPLTALLEQLGIP
KTQLDTILQCSSTNIDAPGECPSDSSTTVDPETVIPDAVATQSAFLVVTGKQKQAPGSFLQVLWRRQRRRNSIQKRITSH

Gene-Specific Links for TGME49_106060

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins