ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_106040 ()

zinc finger (CHY type) protein, putative, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_15670

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • PFI1480w conserved Plasmodium protein, unknown function
  • PBANKA_083110 conserved Plasmodium protein, unknown function
  • PY01868 putative zinc finger protein
  • PY01869 homeobox-containing protein
  • PVX_099985 hypothetical protein, conserved
  • PCHAS_083140 conserved Plasmodium protein, unknown function
  • PKH_072860 hypothetical protein, conserved in Apicomplexan species
  • TGME49_106040 zinc finger (CHY type) protein, putative
  • NCLIV_070000 zinc finger (CHY type) protein, putative
  • cgd2_3460 C- terminal region conserved, zinc finger, myb DNA binding domain
  • Chro.20367 hypothetical protein
  • CMU_003890 hypothetical protein, conserved
  • CMU_022330 hypothetical protein, conserved
  • TA17095 hypothetical protein, conserved
  • BBOV_IV003110 CHY zinc finger domain containing protein
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>TGME49_106040 zinc finger (CHY type) protein, putative
MPNPSSDRQASGRNAGGPAHPNSPMEPRDSHRQNEVSSSLVSACSFRRPAREIPCRFFLQNRCLKNTACPFSHDPSLRRA
RGTPDSSDAASAPPLPRSEPDTCVLSEDLPVLTQHEEAENGINLSWQGRGRGLPGKRGRAGGRRLEPGSVRPASSRATEA
AAPRSPACSPATPEPRERDSFELAGVSSAPIHSIDERPVSGHEERRRNQRQRPHRNDFGDPNRVALPAKGPGPLRGGRKS
GLPSRRQRGNDSRHGSGSQERSHTPSVYSAQGREEQVSPSRKDSEVSPSAKETEERVSPAGGASKRVARPRGAPRDRPPC
VPRRVCPVGPPARADWTWEEERGRLEKLYGSSFCCTFCGRGAKAGAADRVGAGEGEEATPASRGEEGTALVTRDLLGRIP
GSGRDAAGEKREDGGAAERPVEETGEKRDSAGTGAARKCFADTESQIVDVVRVTHVPTDPDFDRNILLNGLTVEITVRAN
YRGCRRHKEKEGGGDERGAGEGRESTTLEQTPSGATTRLPEGATLRVCNEELSDFVRETIPKVFQEYILKNPEEPFVVYG
ALKFVDRHLATVFALSHTHRCGDSGVAPKKGADGRKAENEPEKKGDWTLEEQKRLEEGLVWYRRVADPVTKWKLIGSFVR
TRTAKECAQRFRDCREAILRRAEAAVASNSGGTASPANPSDPATAAAEGTLQEATFAGDEGGESNSSSAVSAPDGDQGAG
GKTGENNLQGATISLAGFQLEGASATHPAALKLLVACDRCKKPADIKLATPKDGTVLDISGTAADCGTCHLRMVVRFQPK
IAFASSSAIAIVETIQCRMRDLLPSDFIVTCDRCTATMKIREVFSGAPRTAICRHCHNKVLLCYQSPSFSGRAETGAETL
TGVTKSLLISTSEKKKKAKDELTLKLGTPLPDNGTCKHYKKSFRWLRFPCCGKAFPCDVCHDDNADHEHAWASRMICGFC
SKEQAFSNRPCECGRALTKDGNTAHWEGGKGCRDAVRMNRKDSRKYKLLSRQQAEAGGNKGGRK

Gene-Specific Links for TGME49_106040

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins