ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_105860 (CDPKif3)

CAM kinase, CDPK family TgCDPK1_2 (TGTPK4), a gene from Toxoplasma gondii

Compiled localisation
cytosol and not microneme during 16 hours after tachyzoite infection
apical during 16 hours after tachyzoite infection and extracellular tachyzoite

Who localised this protein by microscopy?

Sugi, T., Kato, K., Kobayashi, K., Pandey, K., Takemae, H., Kurokawa, H., Tohya, Y., Akashi, H.
Molecular analyses of Toxoplasma gondii calmodulin-like domain protein kinase isoform 3. (2009 Dec, Parasitol Int) PubMed / full text
   more detail about this publication

cytosol and not microneme during 16 hours after tachyzoite infection, apical during 16 hours after tachyzoite infection and extracellular tachyzoite
  • "TgCDPKif3 was localized to the apical ends of tachyzoites"
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: RH
  • Gene model mapping comments: Taken directly from paper, blast from DQ205646, annotation matches
  • Localisation record: cytosol and partially apical end and not microneme during 16h post infection intracellular tachyzoite, apical during extracellular tachyzoite
  • Other genes localised in this publication: MIC2-associated protein M2AP

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10071

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • PF13_0211 calcium dependent protein kinase 5
  • PFC0420w (CDPK3) calcium dependent protein kinase 3
  • PFF0520w (CDPK2) calcium-dependent protein kinase
  • PBANKA_031420 calcium dependent protein kinase 1
  • PBANKA_040820 calcium dependent protein kinase 3
  • PBANKA_061520 (CDPK4) calcium dependent protein kinase 4
  • PBANKA_135150 calcium dependent protein kinase 5
  • PY02109 Plasmodium falciparum CDPK2 protein
  • PY03298 calmodulin-domain protein kinase
  • PY06394 calcium-dependent protein kinase-3
  • PY06527 calcium-dept. protein kinase
  • PVX_000555 calcium-dependent protein kinase 4, putative
  • PVX_002665 calcium-dependent protein kinase 1, putative
  • PVX_082820 calcium-dependent protein kinase, putative
  • PVX_119610 calcium-dependent protein kinase 3, putative
  • PCHAS_031630 calcium dependent protein kinase 1, putative
  • PCHAS_040910 calcium dependent protein kinase 3, putative
  • PCHAS_061690 calcium dependent protein kinase 4, putative
  • PCHAS_135610 calcium dependent protein kinase 5, putative
  • PKH_030080 calmodulin-domain protein kinase, putative
  • PKH_040260 protein kinase, putative
  • PKH_083010 calcium-dependent protein kinase 3, putative
  • PKH_121600 calcium-dependent protein kinase, putative
  • TGME49_006590 CAM kinase, CDPK family
  • TGME49_024950 CAM kinase, CDPK family TgTOXPK2
  • TGME49_042400 CAM kinase, CDPK family
  • NCLIV_011980 Calmodulin-like domain protein kinase isoenzyme gamma, related
  • NCLIV_017560 Calcium-dependent protein kinase 2, related
  • NCLIV_044270 hypothetical protein
  • NCLIV_047750 hypothetical protein
  • NCLIV_070280 hypothetical protein
  • cgd2_1060 calcium/calmodulin dependent protein kinase with a kinas domain and 4 calmodulin-like EF hands
  • cgd2_1300 calcium/calmodulin dependent protein kinase with a kinase domain and 4 calmodulin like EF hands
  • cgd3_920 calmodulin-domain protein kinase 1, putative
  • cgd5_820 calcium/calmodulin dependent protein kinase with a kinase domain and 4 calmodulin like EF hands
  • Chro.20118 CDPK2
  • Chro.20142 calcium-dependent protein kinase
  • Chro.30121 hypothetical protein
  • Chro.50305 calmodulin-domain protein kinase 1
  • CMU_009030 protein kinase domain-containing protein
  • CMU_009310 calcium-dependent protein kinase, putative
  • CMU_041080 calcium-dependent protein kinase, putative
  • CMU_042610 calcium-dependent protein kinase, putative
  • TP01_1073 calmodulin-domain protein kinase, putative
  • TP02_0399 calcium-dependent protein kinase, putative
  • TA12965 calcium-dependent protein kinase, putative
  • TA16180 calmodulin-like domain protein kinase, putative
  • TA16570 calmodulin-domain protein kinase, putative
  • BBOV_III005470 protein kinase domain containing protein
  • BBOV_IV003210 calcium-dependent protein kinase 4
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_105860 CAM kinase, CDPK family TgCDPK1_2 (TGTPK4)
MGCVHSKNPHSKHAGAAGEKPDASLEKGGQSKGSAPSSGTGDSGKGTGSPDTKRDSMPMTPGMYITQQKAHLSDRYQRVK
KLGSGAYGEVLLCKDKLTGAERAIKIIKKSSVTTTSNSGALLDEVAVLKQLDHPNIMKLYEFFEDKRNYYLVMEVYRGGE
LFDEIILRQKFSEVDAAVIMKQVLSGTTYLHKHNIVHRDLKPENLLLESKSRDALIKIVDFGLSAHFEVGGKMKERLGTA
YYIAPEVLRKKYDEKCDVWSCGVILYILLCGYPPFGGQTDQEILKRVEKGKFSFDPPDWTQVSDEAKQLVKLMLTYEPSK
RISAEEALNHPWIVKFCSQKHTDVGKHALTGALGNMKKFQSSQKLAQAAMLFMGSKLTTLEETKELTQIFRQLDNNGDGQ
LDRKELIEGYRKLMQWKGDTVSDLDSSQIEAEVDHILQSVDFDRNGYIEYSEFVTVCMDKQLLLSRERLLAAFQQFDSDG
SGKITNEELGRLFGVTEVDDETWHQVLQECDKNNDGEVDFEEFVEMMQKICDVKVKH

Gene-Specific Links for TGME49_105860

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins