ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_105180 (NHE3) *

* The amino acid sequence is recorded as differing between ApiLoc and the genome database. See the gene model mapping comments in each localisation for more information.

sodium/hydrogen exchanger, putative, a gene from Toxoplasma gondii

Compiled localisation
plant-like vacuole during extracellular tachyzoite
not apicoplast and not mitochondrion and not rhoptry during intracellular tachyzoite

Who localised this protein by microscopy?

Francia, M. E., Wicher, S., Pace, D. A., Sullivan, J., Moreno, S. N., Arrizabalaga, G.
A Toxoplasma gondii protein with homology to intracellular type Na/H exchangers is important for osmoregulation and invasion. (2011 Jun 10, Exp Cell Res) PubMed / full text
   more detail about this publication

plant-like vacuole during extracellular tachyzoite, not apicoplast and not mitochondrion and not rhoptry during intracellular tachyzoite
  • "TgNHE3 (red) localizes to the PLV/VAC as represented by TgVP1 (green) in extracellular tachyzoites of T. gondii."
  • Microscopy type: fixed light
  • Microscopy method: antibody to residues 917-116
  • Strain: RH HPT-
  • Gene model mapping comments: Blast from GU230797.1, gene model inconsistent?
  • Localisation record: PLV/VAC during extracellular tachyzoite, not apicoplast and not mitochondrion and not rhoptries during intracellular tachyzoite
  • Other genes localised in this publication: H+-translocating inorganic pyrophosphatase TVP, putative, cathepsin L-like thiolproteinase, putative
  • "TgNHE3 (red) localizes to the PLV/VAC as represented by TgVP1 (green) in extracellular tachyzoites of T. gondii. … Thus, in general, TgNHE3 appears to have a localization pattern similar to that of VP1 and occupies the same region as TgCPL while the parasites are dividing."
  • Microscopy type: fixed light, EM
  • Microscopy method: HA tag
  • Strain: RH HPT-
  • Gene model mapping comments: inferred from another publication
  • Localisation record: PLV/VAC during extracellular tachyzoite, not apicoplast and not mitochondrion and not rhoptries during intracellular tachyzoite
  • Comment: genomically integrated, native promoter
  • Other genes localised in this publication: H+-translocating inorganic pyrophosphatase TVP, putative, cathepsin L-like thiolproteinase, putative

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10194

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_105180 sodium/hydrogen exchanger, putative
MGEKGALGEVEARGVAFPSFADELTREKRRKCLDNSGKDIFAALPDEPQQAASEECLSFTKRKTGKEDPVPRGPLCGSSL
GCTYSGREPSSSGRCHLSPQESSQDGEKLKEAANIPWRRLSGFKLGDGGGARFSPSVCPSAACSSSASLLSRSTVLRGSS
LSPHSLPSSFLAVSLSSFFPPKRSSSPLTPSSSSDSSLSSTSLILSGPSSLPLCFPSSSRLPSCFSVSPFSVSVALLACV
SPAPHAPAVSHCRYTKRQTGGKAAGEEHGARLTRVSFLRYFRFPWRFLSWVRKAAERKGRVEGRATAVSKTRQIKRGFCR
SLCVSGTLWLFVLFHLLSVVCEGVPRSETDHRGLPLETKKLAADSAPSLPRAHLPLPSPLAESSRHRRLASESSSSSSPS
PSSSSSPSSSSSPSPSSPSSSSSPSSSPSSPSSSSSPSPSSPSSSRSSSPSLGSRAMSFLLGRGSENAQKTEDQKGDSVS
PSSPSPSPTAAALDAPLLAGVSSGASETVSSSGAKGEASGAQNDPAKTETAATRPEPESASTSASPPTRSPAASTEGTPS
SALDHPDGEKDEAGGAEREEGEKGSKSREEPPPPVFRVSSTSPSNAAVFVPAVFQQNSGEGNHVTLTIPLEVLPSLAAAG
ETAAPHPEEKLASQGSDKERLALSSLQWLPARESGAREGEASLHHMGEKRRRGALAQMGASGEEVPETSPASLEELSSNE
REMVLSAGLLTLLLVLSVSLVLSHVSRKCHLRWLQMPVAATLLGLLVGAVLKFGLKVQGPILGSVLAMNEDVFFVMLLPP
IIFEGGLSLSEGSLSGPFMRNFGAIMWLACFCTILSFCWVGTLMFFGGVLGLSMFLTVRQAFAFGALISSTDPVSVLALF
KELHAKKLIHVLVFGESLLNDAISIVLYRTIASEDTASVGSAILAFFLTFFVSLVIGLAVGLFCALTYKYMDLHKEENQT
LESALLLLFPWMAYLVADGLGYSGIVAICFCGVTIGKYAVPNLSTSARTASRSVFNSFSLLAETVVFAFLGLAVFSFDQP
LHDELAVGLYVLGFVATFSARAVSVFVTCTLINLFRTNAKITPQQQLALVLCGLRGAIAFALSERARRDFGGKEGAALLS
LTLFLALFTILVLGEKRESGLSWDDLRRSLGVHTPEGLRRQQGEGGAREVAMTALPLKGRQAPGLRAEASGETEERRPSG
KVSARCEAKGGDTDDEDAPRFRAPGLERDEMRGRERREDERSREGSCGRGERETGVEDPFTEEDFDDVRVALPDALRASA
LLSDSENQEFHSEEESWTERIESFSATPESLPVVVGRGGMRGDRRRDSISEEMRDRVPEKAGAQGFELQNGWQPNGHQNG
VERETDARETIVGKRQVL

Gene-Specific Links for TGME49_105180

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins