ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_105160 (H2Ba)

histone H2B, putative, a gene from Toxoplasma gondii

Compiled localisation
nucleus

Who localised this protein by microscopy?

Dalmasso, M. C., Onyango, D. O., Naguleswaran, A., Sullivan, W. J. Jr, Angel, S. O.
Toxoplasma H2A variants reveal novel insights into nucleosome composition and functions for this histone family. (2009 Sep 11, J Mol Biol) PubMed / full text
   more detail about this publication

nucleus
  • "As expected, each aH2A antibody stains the parasite nucleus (Fig. 3b)."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: RH
  • Gene model mapping comments: Taken directly from 16621068
  • Localisation record: Nucleus
  • Other genes localised in this publication: histone H2A, histone H2A, putative, histone H2A, putative, histone H2B variant 1

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10044

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_105160 histone H2B, putative
MVAKKSAKSAKPKASGKSGKGKKKRAESYSSYIFKVLKQVHPETGISKKSMMIMTSFIADTFDKIASEAGKLCKYNKKDT
LSSREIQTAVRLVLPGELAKHAVSEGTKAVTKYTGK

Gene-Specific Links for TGME49_105160

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins