ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_100380 ()

endoplasmic reticulum oxidoreductin, putative, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_11273

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • PF11_0251 endoplasmic reticulum oxidoreductin, putative
  • PBANKA_092430 endoplasmic reticulum oxidoreductin, putative
  • PY07009 hypothetical protein
  • PVX_091815 endoplasmic reticulum oxidoreductin, putative
  • PCHAS_092010 endoplasmic reticulum oxidoreductin, putative
  • PKH_092150 endoplasmic reticulum oxidoreductin, putative
  • TGME49_100380 endoplasmic reticulum oxidoreductin, putative
  • NCLIV_060300 cDNA, FLJ96396, highly similar to Homo sapiens ERO1-like beta (S. cerevisiae) (ERO1LB), mRNA, related
  • cgd8_3190 endoplasmic reticulum oxidoreductin
  • Chro.80371 hypothetical protein
  • CMU_023730 endoplasmic reticulum oxidoreductin 1 family protein
  • TA04395 oxidoreductin, putative
  • BBOV_IV002420 endoplasmic reticulum oxidoreductin, putative
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_100380 endoplasmic reticulum oxidoreductin, putative
MSHYTCGAYDCVVGGGPTSTPPVNNAVFLFALLVLVCLHFPSLTQLSEDARIVQPILHRLKQRTFFRIFKLSLLADTCAD
PRLDHLLRDNADKCTEPQRCGLCQCSDDEIPQTWRQKPDEEFVDRRHSASFTRWTQDQSSRQPDDPFSMFKTPERLQGGT
FPKRNVTQATGVYVDLLLNPPCFTKYDGGAVWRLLYDQVPLPHLQNEGAVAGSGKSSESENLFPESLNDPHLSGASSAWA
CSNNANLRRFLSGMQANIAALAAANFNTRDDAPPPMPYPTTSMVPPNSGGNGGNGTPAPPVFISNLDFFRERLAVHPARI
QNLYFTFGVLLRAACGLTDILQECSCETGNNREDLSTRAELLHMLNVTTSSLHACSSDHMNESFFDSSRLHFLQTTEGID
KLLRCVPCEKCRLHGKIKLTALHIAARMLSPLHAMPSLERNQVAALINALYYFAESIRVVEHMQDRIYMHNVSVCAFFIA
LLLLVLLFIVYFVWTSGVRSRRKRRQKLMLSKKKLI

Gene-Specific Links for TGME49_100380

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins