ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_099070 (PK II, PyKII) *

* The amino acid sequence is recorded as differing between ApiLoc and the genome database. See the gene model mapping comments in each localisation for more information.

pyruvate kinase, putative, a gene from Toxoplasma gondii

Compiled localisation
apicoplast during intracellular tachyzoite and tachyzoite
apical end of endoplasmic reticulum and mitochondrion during tachyzoite

Who localised this protein by microscopy?

Saito, T., Nishi, M., Lim, M. I., Wu, B., Maeda, T., Hashimoto, H., Takeuchi, T., Roos, D. S., Asai, T.
A novel GDP-dependent pyruvate kinase isozyme from Toxoplasma gondii localizes to both the apicoplast and the mitochondrion. (2008 May 16, J Biol Chem) PubMed / full text
   more detail about this publication

apical end of endoplasmic reticulum and apicoplast and mitochondrion during tachyzoite
  • "TgPyKII possesses a long N-terminal extension containing five putative start codons before the conserved region and localizes to both apicoplast and mitochondrion by immunofluorescence assay using native antibody and fluorescent protein fusion to the N-terminal extension."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: RH
  • Gene model mapping comments: Blast from AB118155.1, annotation matches, gene model inconsistent
  • Localisation record: apicoplast and mitochondria and apical end of ER during tachyzoite
  • Comment: dual localisation via alternate splicing messes up the gene model?
  • Other genes localised in this publication: ferredoxin NADP+ oxidoreductase, putative, acyl carrier protein, heat shock protein 60

Fleige, T., Fischer, K., Ferguson, D. J., Gross, U., Bohne, W.
Carbohydrate metabolism in the Toxoplasma gondii apicoplast: localization of three glycolytic isoenzymes, the single pyruvate dehydrogenase complex, and a plastid phosphate translocator. (2007 Jun, Eukaryot Cell) PubMed / full text
   more detail about this publication

apicoplast during intracellular tachyzoite

Orthology

OrthoMCL

Part of OrthoMCL group OG4_25260

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>TGME49_099070 pyruvate kinase, putative
MDDGGAEFSSSRANGFASMNFPTCGSEKPVRKNSSGFRSTRTEAHIDLQNFSRFPGGERGLREHTLSVRVSSRPRLLLRF
FFFCFLALLLSAMAPLRPSPASVCTRVAAVATGHRRVGLPSMDFPRVFESRALQRSGSQARKVLFSTGTEKTRVQPDFSA
QKAQNLRQRTCDCLADLTQGIPHRPIRHECPVRFHREASVPPVAPHIGFLSSRLAEGVSSSSFAAPASSRAGKAGQDASL
LQTSSSGRRPTETAAFLLTGFPSSPSACSPFAASLSREESGPRAGLETHRGMLSAASPALARKSFDFRGSALRHFSSSGG
HRGSSDTKISPGHSDKSGEPLDLPVFTSTKQIATIGPASWDYEEIERLFLAGVDVFRLNMSHGLLTEKHQQLLHVRHLEK
VYKHPIAVLADLPGPKFRLGVFNNDEATLETGKSFILDSSTQPGDASRVQLPHPEILSVLRPDDIVLMDDGKVKLRVTEV
FADTTALSRGLGDIESVSHTASPGSSVVRAPAVRCTVLVGGRISSKKGVNVPSARLPISALSARDRELARTVASWGVDWI
ALSFVQSADDVHELRRELREAAEAAGSTTAQYAAEQNRSESHVDRGDASGAGCRIRPDISVMVKIEKPIALENIAEIVAA
ADGIMVARGDLGVELPNIAWLPRVQKRLVSLCREAGKPVVVATQMLESMMQAPLPTRAEVSDVANAVYDGADAVMLSGET
AAGNAPARVACMQRLGIEGVENDPSFWELEDQRRQARLRAAERCASTGTSALRVPRASKGREQELEKGSELQGESRDRTE
EILSRFLPGRREHLAFSEADRQGKSGDTNQGTSKTEQGADESDAWVEHTAAAVARQSGAKAIVVFGENEALLQRLATLRP
TAPVLAVTECVHTARRLKMYWGIYPVLLEAEDQENVESRARRPASLDDQLRLACEFARKEKFATESTDNLVVLGRLPGGR
ENGTNSDKTTARLTRPILTVCTLESGR

Gene-Specific Links for TGME49_099070

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins