ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_099060 (NHE2) *

* The amino acid sequence is recorded as differing between ApiLoc and the genome database. See the gene model mapping comments in each localisation for more information.

sodium/hydrogen exchanger, putative, a gene from Toxoplasma gondii

Compiled localisation
rhoptry during day 4 bradyzoite and intracellular tachyzoite

Who localised this protein by microscopy?

Karasov, A. O., Boothroyd, J. C., Arrizabalaga, G.
Identification and disruption of a rhoptry-localized homologue of sodium hydrogen exchangers in Toxoplasma gondii. (2005 Mar, Int J Parasitol) PubMed / full text
   more detail about this publication

rhoptry during day 4 bradyzoite and intracellular tachyzoite
  • "To determine whether TgNHE2 expression is stage-specific, day 4 in vitro bradyzoites were stained with the TgNHE2 antibody. As in tachyzoites, TgNHE2 localized to the rhoptries (Fig. 2D)."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: RH HPT-
  • Gene model mapping comments: Blast from AY735393.1, annotation matches, gene model inconsistent
  • Localisation record: rhoptry during intracellular tachyzoite
  • Other genes localised in this publication: Rhoptry kinase family protein ROP4 / ROP7 (incomplete catalytic triad) ***WARNING: GENE MODEL INACCURATE ***
  • "To determine whether TgNHE2 expression is stage-specific, day 4 in vitro bradyzoites were stained with the TgNHE2 antibody. As in tachyzoites, TgNHE2 localized to the rhoptries (Fig. 2D)."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: Prugniaud
  • Gene model mapping comments: inferred from another publication
  • Localisation record: rhoptry during day 4 bradyzoite
  • Other genes localised in this publication: Rhoptry kinase family protein ROP4 / ROP7 (incomplete catalytic triad) ***WARNING: GENE MODEL INACCURATE ***

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10194

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_099060 sodium/hydrogen exchanger, putative
MSAHTETMTLGIPLSPTGELVDAVPHATAATEHLHEHAIVMIIASISFIYLLSAVLAGLVGLLPKFRPPITVVLFLAGMS
LQPLLEWMQNRVLLQGIRLIGNVDPYLIFFALLPMCLYESSAFVNYHMFKQVLPSSLLLAIPGVAVNIGLVGVFLRYGVS
RVYDWPAALMTASIVSATDPVAVIACLRALGAPEKLSSLIDGESLLNDGSAVVFFEVFRSIVIGTYTGVGSSVVLFSQLS
FGALGYGLAVAIVLYLWLLTVREFEIVQVTGTIAAVFTVFFTADHFLHVSGVLAVVTLGIFMAAKGSTALQRSIQKLHHE
SVELLSTLSVQAIFVCGGVIASRLLIQYADTWQEWVELLLLFAVLQTARFAVVFGSWPFITWMGLPLSWKECFIISYGGL
RGVICLALGLVVEADPLISPTLREHVGICVAGTVIFTLLINGTTAELAYTRLRLYPISKYRREYLDSVLASIDVSFNRKK
NELKDYWLFRGTDVVQAANEALPQFSKGHLDVNGNLHIPTKSFREVLRNPPSCENWNVQAQVTGLAKLESRDFGVPSQLG
DWTHGLVSTIKNVKQLTSRQQRSPESRDDQHNPEEVTLVDKEAGQLEKEVHVLHIMFSAMREFYSGMYKRSNIGGTACLL
LTSTVDKCHSHLDAQLHDMTTNKKSRKNANNTNVFSFEWEVLLASLRTRYGLWKCLNAMPCDAFDLLKSYLISIIETLYA
VVEAHEFVNQSNRKEMEELISQATLMPSDDVVTSAKELLEKLRNTFPVAFSQCLVIIAAHMLLNAKQKVLDEEIERGLVF
PEDADKLNEALIEQRMMLERIIR

Gene-Specific Links for TGME49_099060

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins