ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_099040 ()

phosphatidylinositol N-acetylglucosaminyltransferase subunit, putative, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_12156

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • PFI0535w phosphatidylinositol N-acetylglucosaminyltransferase, putative
  • PVX_098990 phosphatidylinositol N-acetylglucosaminyltransferase domain containing protein
  • PCHAS_081240 phosphatidylinositol N-acetylglucosaminyltransferase, putative
  • PKH_070840 phosphatidylinositol N-acetylglucosaminyltransferase, putative
  • TGME49_099040 phosphatidylinositol N-acetylglucosaminyltransferase subunit, putative
  • NCLIV_009460 phosphatidylinositol N- acetylglucosaminyltransferase subunit, putative
  • cgd1_3380 phosphatidylinositol-glycan-class c, pigC, 8x transmembrane domains
  • Chro.10380 phosphatidylinositol-glycan-class c
  • CMU_020210 hypothetical protein, conserved
  • TP01_1147 hypothetical protein
  • BBOV_IV011600 hypothetical protein
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_099040 phosphatidylinositol N-acetylglucosaminyltransferase subunit, putative
MTCAHPPAALDATDDPRTAGFRRRQKLSEDLLRLSRSRRYSDCPPPGPLLSGGDRLPDEVHPAPARWEKVLWRRQAYPDN
YVDDSFLDSLICNANMRAYVYADLCRATAAVTQHISLLVDFTVVYIMLEKKRISVGSLFAVDLALLFFGFVLRLLADEAL
HKTWRGLWSSFVGMGCLRILAPILRTLTQTFSEDTVVCLSVVSLLVHTALTDYSYIYRNPDKVDESLQRAMSINAALLAN
VVLASRLSSSTEVFAVLIFGIEIFTISPMARRILWQKYPWAFVHVFTPTLVLSTALLLSLEAPASIVLLFLFSIVFITFV
GPYWLISSQKYKHEIKGPWDVAEVPNYA

Gene-Specific Links for TGME49_099040

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins