ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_098990 (FNR)

ferredoxin NADP+ oxidoreductase, putative, a gene from Toxoplasma gondii

Compiled localisation
apicoplast during intracellular tachyzoite and tachyzoite

Who localised this protein by microscopy?

Pino, P., Aeby, E., Foth, B. J., Sheiner, L., Soldati, T., Schneider, A., Soldati-Favre, D.
Mitochondrial translation in absence of local tRNA aminoacylation and methionyl tRNA Met formylation in Apicomplexa. (2010 May, Mol Microbiol) PubMed / full text
   more detail about this publication

apicoplast during tachyzoite

Saito, T., Nishi, M., Lim, M. I., Wu, B., Maeda, T., Hashimoto, H., Takeuchi, T., Roos, D. S., Asai, T.
A novel GDP-dependent pyruvate kinase isozyme from Toxoplasma gondii localizes to both the apicoplast and the mitochondrion. (2008 May 16, J Biol Chem) PubMed / full text
   more detail about this publication

apicoplast during tachyzoite
  • "Parasites stably expressing ptubFNRL-YFP-HA (labeling apicoplast, green) were stained with MitoTracker Red CMXRos (red) and anti-TgPyKII antibody (blue)."
  • Microscopy type: Light
  • Microscopy method:
  • Strain: RH
  • Gene model mapping comments: inferred from another publication
  • Localisation record: apicoplast during tachyzoite
  • Comment: Possibly YFP or HA tag – couldn't determine this from publication – both are on the construct
  • Other genes localised in this publication: pyruvate kinase, putative, acyl carrier protein, heat shock protein 60

Fleige, T., Fischer, K., Ferguson, D. J., Gross, U., Bohne, W.
Carbohydrate metabolism in the Toxoplasma gondii apicoplast: localization of three glycolytic isoenzymes, the single pyruvate dehydrogenase complex, and a plastid phosphate translocator. (2007 Jun, Eukaryot Cell) PubMed / full text
   more detail about this publication

apicoplast during intracellular tachyzoite

Seeber, F., Aliverti, A., Zanetti, G.
The plant-type ferredoxin-NADP+ reductase/ferredoxin redox system as a possible drug target against apicomplexan human parasites. (2005, Curr Pharm Des) PubMed / full text
   more detail about this publication

apicoplast during intracellular tachyzoite
  • "Immunolocalization of T. gondii ptFd in the apicoplast of intracellular parasites using a polyclonal antibody raised against recombinant T. gondii ptFd (I). For comparison the co-localization of T. gondii ptFNR, transgenically expressed as an HA-tagged protein [80], is also shown (II)."
  • Microscopy type: Light
  • Microscopy method: HA tag
  • Strain:
  • Gene model mapping comments: inferred from another publication
  • Localisation record: apicoplast during intracellular tachyzoite
  • Comment: strain information not found
  • Other genes localised in this publication: ferredoxin

Harb, O. S., Chatterjee, B., Fraunholz, M. J., Crawford, M. J., Nishi, M., Roos, D. S.
Multiple functionally redundant signals mediate targeting to the apicoplast in the apicomplexan parasite Toxoplasma gondii. (2004 Jun, Eukaryot Cell) PubMed / full text
   more detail about this publication

apicoplast during tachyzoite
  • "The fusion of either the full-length TgFNR gene (18) or the complete TgFNR leader (TgFNR-150, including both the presumed SS and the TP) (Fig. 1a) to a YFP reporter targets YFP to the apicoplast in T. gondii (Fig. 1b)."
  • Microscopy type: Light
  • Microscopy method: YFP tag
  • Strain: RH
  • Gene model mapping comments: inferred from another publication
  • Localisation record: apicoplast during tachyzoite
  • Other genes localised in this publication: -

Striepen, B., Crawford, M. J., Shaw, M. K., Tilney, L. G., Seeber, F., Roos, D. S.
The plastid of Toxoplasma gondii is divided by association with the centrosomes. (2000 Dec 25, J Cell Biol) PubMed / full text
   more detail about this publication

apicoplast during tachyzoite

   17784785 (unpublished) full text
   more detail about this publication

apicoplast during intracellular tachyzoite

Orthology

OrthoMCL

Part of OrthoMCL group OG4_16387

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_098990 ferredoxin NADP+ oxidoreductase, putative
MVRGIRPRVYFAFVAVVASVAISVQEVVSFRVAKRGPHVIDHGDTASCGVRVFDSSSTAYLGPLRAAATANSVLGYQGRF
RGVSSFLLPGATRQCSDRRRTHCLPKSSEGFLPQWGTLERPLSVRLDRSSTRKRSDTPTGLFATPTDQTSVDAKADELRV
AVNTFRPASPLICRVVSVTPVTSKDSSPGDSHGEAPQVFSIVLHHGKQLPFVEGQGIGIMPPSRAAQAPVADESTSQRNS
VQPDGQGQQPTTVASICKRRLLPRIYSIASSRDGDDGCGSTLTLCVKKHIYADPVTGKRDRQKDGICSTYICDAKCGDEV
EVTGPVGKTLLLPTSTETPLVMLATGTGVAPFRSHLQALRRKLLSAGGPSAAQPANRPKVLLFIGARTAAAVPYMNEWRD
IEAQRDGNFVDIHFALSRQMKNPQGKKLYIQDVVWQEREKVWKALDRDGGHLYACGLKNMMVGVHEVLGNMAEEKGLPRD
HLASLLKHQRRWHVEVY

Gene-Specific Links for TGME49_098990

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins