ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_098630 (VTC2)

SPX domain-containing protein, a gene from Toxoplasma gondii

Compiled localisation
cytoplasm during extracellular tachyzoite and intracellular tachyzoite
not acidocalcisome and not dense granule and not microneme during intracellular tachyzoite
not plant-like vacuole during extracellular tachyzoite

Who localised this protein by microscopy?

Rooney, P. J., Ayong, L., Tobin, C. M., Moreno, S. N., Knoll, L. J.
TgVTC2 is involved in polyphosphate accumulation in Toxoplasma gondii. (2011 Apr, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

cytoplasm during extracellular tachyzoite and intracellular tachyzoite, not acidocalcisome and not dense granule and not microneme during intracellular tachyzoite, not plant-like vacuole during extracellular tachyzoite

Orthology

OrthoMCL

Part of OrthoMCL group OG4_14575

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • PFL1455w conserved Plasmodium protein, unknown function
  • PBANKA_144490 conserved Plasmodium protein, unknown function
  • PY03770 possible negative regulator of cdc42p-related
  • PVX_124150 hypothetical protein, conserved
  • PCHAS_144710 conserved Plasmodium protein, unknown function
  • PKH_144710 SPX d0main containing protein
  • cgd6_3330 membrane associated protein with a SPX domain (SYG1, Pho81 and XPR1) domain at the N-terminus and a vtc1p domain at the C-terminus. 3 transmembrane domains near the C-terminus.
  • Chro.60386 G-protein associated signal transduction protein
  • CMU_031390 SPX domain-containing protein
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_098630 SPX domain-containing protein
MKFSKQLSAQADLRYLNEYISYKDLKKAIKVITGSDVQVCTVQDVVSNFRQTNALTGSIFRPPESRFQELLNHELDKINS
FSKREVEAILDQLAVALVIMWRLHAALTLLRLAPDSPGYAEAQALLKRLEQREQEIRNALVVYPQKRGRATEQDKAGSPS
SNPRCRGVSDEPSSSSEERELGAEGDDFSSAGGKTSSRGEGDAKRRQGDEDGGEGEQDDAKRSVAEALILLEKDVLEVEG
VLEAQSQEIVFLDSFVRLNFTGFRKITKKYDKHNQSSAASWYMSRVVRQDFMNLNFTLLLTRLARCYVALRSLRRRLGEQ
QQQSLSISPADDPSKAASVKEDRSTVGSFSQSLGPEGARLSTYKRTGGSDEGEQRREPRFSLAARSRGSRDCREDIKVTK
YLIAPDELMKVKVLILKHLPLLAAGGIPMDDSVLCPFENSSQAVAAEDFSAALEAAASLLRTSGTASDKREARQSLGGSR
VPTWEVYLDNEEFTYYTNTRTRRDSPDSCRGVAPSRRVVRVRWQGLPSLNSAGRQVALELSRPDSSIADPQEDITTPLAS
NAPDVASSAFTVILRQKQLLQLLHGLITPSKLLDQLMDEMEASAAGVATGEGANATAASHRTGARGAANRGEGSGGGGGN
RGSDDRAVALTKQKRKADMLQVLQTVWDAVQQRGVSPSVRTWFYRTEFMSEDGVAWISVDEDIRFSREMNRTPPANQWIR
SETEALSTDDVHPFPWGLLDVSFLVRDNGVALPQHAVQQAKDFHPLVGRDDLEDFVADLRGLSTLTEVPGFSLFAHGTAY
FYTPRLQALQARMSGYEQAVHLIPLWLQYTTNAEFDDDASQVFDEATEGGKGKKADRTSVGQSRLGRNQGDSAERGQRAG
SPGGLSRPRVCHRGSVIDVVHQGTSASLVHDLQASAQVSPPTSSGVDQLGNSHRPSVSESRHPSAPALSVLASAPSLPMP
APPLLEVSPFQSGARGLLTQPLLDDGDRMAGERQSASRGGAPTPSQSWLLTGARYWRRYCNCFSLSGSAGRRRRSMSCLF
PWSQRSSARRIHPVGPRSMVAGGVTSGPSVRVEPKTFFANERTLLQWMNTAVLIATISITLMNFGNPVGRIAGLLMSPVA
VFFIGYSFWVYLRRARALERKEPIAYNDKLGPSILVVTLMLSLSAVIALNLLYHEGEAQLPITPQNSSTSTAPSLPPSPH
ALPLLSQLNVSHSQAAYKAPSAPNATVNAGGYSVADVPAPDFSLSHPATAYAAATALAAAEAAAAAGPVSFAGAPERAVH
AHVTEAMTHAASAETAAAEGARVTAGAK

Gene-Specific Links for TGME49_098630

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins