ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_097520 (PPG1) *

* The amino acid sequence is recorded as differing between ApiLoc and the genome database. See the gene model mapping comments in each localisation for more information.

hypothetical protein, a gene from Toxoplasma gondii

Compiled localisation
during not tachyzoite
cytoplasm and developing cyst wall during bradyzoite

Who localised this protein by microscopy?

Craver, M. P., Rooney, P. J., Knoll, L. J.
Isolation of Toxoplasma gondii development mutants identifies a potential proteophosphogylcan that enhances cyst wall formation. (2010 Feb, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

during not tachyzoite, cytoplasm and developing cyst wall during bradyzoite
  • "The bradyzoite localization of TgPPG1 suggests its association with the developing cyst wall."
  • Microscopy type: Light
  • Microscopy method: C terminal HA tag, N terminal FLAG tag
  • Strain: 42F5
  • Gene model mapping comments: taken directly from publication, gene model inconsistent?, CDS length doesn't match, UTR doesn't match, blast from GU182879, annotation doesn't match
  • Localisation record: not during tachyzoite, punctate cytoplasm and developing cyst wall during bradyzoite
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_25866

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>TGME49_097520 hypothetical protein
MPAPPPSPSLLSPSPAGVSSASSSSSSSSQGAQKSARGPAAAGSSALRSSSEVSPPSPAAGLPRDACRLETAVSSTALAK
GRPGPPSPRGARRSSSTVSTKSIPSKKLSARSLKKETKSASPDSEQKKSKEKVNAASKKSLASPQLAPETDTGVRGSRTD
DAAQRPQSLESTVGTEALPSSSKSPSLIHGSSSSSAGASSSPVESLSSASASSFSPRLGRNEGASHGVEASSAAEENSGI
SEASASCQRRVLKGGDICVAEARAQKGEEDEEATRHRRVIERVSEDFLAFSAGVSRQAERPSMRTLFPQASGRCDDADNE
ISLDSKAPEASEFLASGALLSERSSWLRELVSPARKDLENSATHIAVGLSFSPSPPLSLSAASSAPPSSPPCAASRLASP
AHSGRASTLPHSSSASPPPASSPCSSSCSSSSAGFEASFALGETPGGPQAGDRPVFLDAASQAKAASLPLSEKKEAREGQ
FARLTGTGDRASLVFSEEKPPRLSGVEAFGKTEQPEQKRDEREEESSEERADGRWAPRRGNAEQIASPEAEDKRETRSCA
EHFFELTLEEKLHRRRVQDQVDGQQRFLLGDSRASRAAALAGAAAALDVSAEKIEKDSLMQSSKRTFGGKIAFWRRTQLH
ATTDNPEIQNKHLHLLLESPSLCAPTQNDCSMSWRFRIVKFFHCVILSSEENAHLQNQVKEAQALCLEMKDRQNQLADSF
YRDAHRHQTSLLELANTEAEGRELVVNRLTFESAKKDRIIETLHSQLAAKEEEIYELTHAVEDLRDWQRKMQGGQVAAVV
QRQKDADARVALAQAECRSHLADKDVLLQRLRQVEEAMKIKDEEIRVAHERLQDQETEAQKVLRKMQGMQFDMDLMRLHI
ADMEKAAKNKEEAMDVELKRQRERDRHKQQSELERLSETMKERAAQVEELEQTVRILRKENAHLRDGVGKVTEVLKSREK
ALSELQEQLAELEAHAHINDKSVQVELLRRGERELKKRLAEQTSRIDVLQQDSLILAQTRAENLDLRLKLEECEAALRRQ
GAQLAILRHAHATNRISALMDIMGDGKDFDFLSSVTSNPMLSASSRPSTSRLPFPSTSHLFGSYPPAGSPSSRPSSASRS
PSLPSQLKGFADPRSSLPQVSVAPSPCESLALRSVANPALRPAVSSAASRHYTPTASALLPLAVSSSQTDASGANASLSA
SAKTSERARVLENTVSSSLSLLRDTEDVAACTRRPAAVASGQGSMFAEEDARGQGEEEAGGRRKQSGASHAVEAAEETSE
GREGEKEGTQKKQREEPAPAAPGVDSRNSDCQAEDGRREAKRGASHSRDIGGEQRNDAALPLTGSCFQDRPALVSPDTIE
TGMAKRLDPIERCVREWMRQSLPPGVSLPFVRISEGLYLHEGETVKVRLVNGILMAHTPEGWISLRAFLQKSSFLSRLRG
VSPASGHELSGKDAPFSAAMNVGPRSLVYSSPLDRSPPELHASSSLLRSSENFCSSIPRQGTHSSLSGRLPTSLSSFFPH
PYSVGPSSGSASISVPSLSCSLPPSLPVPSSLPGANSPFR

Gene-Specific Links for TGME49_097520

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins