ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_095350 ()

nucleoside diphosphate kinase, putative, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10163

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • PF13_0349 nucleoside diphosphate kinase
  • PBANKA_114240 nucleoside diphosphate kinase b, putative
  • PY04911 nucleoside diphosphate kinase
  • PVX_115285 nucleoside diphosphate kinase A, putative
  • PCHAS_114190 nucleoside diphosphate kinase b, putative
  • PKH_110410 nucleoside diphosphate kinase b, putative
  • TGME49_095350 nucleoside diphosphate kinase, putative
  • NCLIV_002390 Nucleoside diphosphate kinase (EC 2.7.4.6), related
  • cgd4_1940 putative nucleoside-diphosphate kinase
  • cgd5_1470 signal peptide containing protein having a NDK (nucleoside-diphosphate kinase) domain
  • Chro.40219 nucleoside diphosphate kinase
  • Chro.50237 nucleoside-diphosphate kinase
  • CMU_016590 nucleoside diphosphate kinase, putative
  • CMU_040410 nucleoside diphosphate kinase family protein
  • TP02_0422 nucleoside diphosphate kinase, putative
  • TA13095 nucleoside diphosphate kinase, putative
  • BBOV_III005290 nucleoside diphosphate kinase family protein
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_095350 nucleoside diphosphate kinase, putative
MAAKQQERTYIMVKPDGVQRGLVSEVIRRFEQRGYKLVALKMKSPDATLLEEHYADLKGKPFFPGLISYMTSGPVVCMVW
EGTDVVKQGRRMLGETRPLESNPGTLRGDFCIDVGRNIVHGSDSVESANKEISLWFTPEEICEWTSAQHKWVYEQ

Gene-Specific Links for TGME49_095350

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins