ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_095110 (ROP4)

Rhoptry kinase family protein ROP4 / ROP7 (incomplete catalytic triad) ***WARNING: GENE MODEL INACCURATE ***, a gene from Toxoplasma gondii

Compiled localisation
rhoptry during intracellular tachyzoite and tachyzoite
parasitophorous vacuole membrane during after tachyzoite invasion
apical and prerhoptry during tachyzoite

Who localised this protein by microscopy?

Parussini, F., Coppens, I., Shah, P. P., Diamond, S. L., Carruthers, V. B.
Cathepsin L occupies a vacuolar compartment and is a protein maturase within the endo/exocytic system of Toxoplasma gondii. (2010 Jun, Mol Microbiol) PubMed / full text
   more detail about this publication

prerhoptry during tachyzoite

Gilk, S. D., Raviv, Y., Hu, K., Murray, J. M., Beckers, C. J., Ward, G. E.
Identification of PhIL1, a novel cytoskeletal protein of the Toxoplasma gondii pellicle, through photosensitized labeling with 5-[125I]iodonaphthalene-1-azide. (2006 Oct, Eukaryot Cell) PubMed / full text
   more detail about this publication

apical during tachyzoite
  • "PhIL1-GFP localizes to the parasite periphery. It is also concentrated at both ends, but in particular the apical end, as seen by dual fluorescence localization with the apical rhoptry protein ROP4."
  • Microscopy type: Light
  • Microscopy method: Monoclonal antibody directly to protein
  • Strain: RH(EP)
  • Gene model mapping comments: inferred from another publication
  • Localisation record: apical during tachyzoite
  • Other genes localised in this publication: hypothetical protein, membrane skeletal protein IMC1, SRS29B (= SAG1, P30)

Karasov, A. O., Boothroyd, J. C., Arrizabalaga, G.
Identification and disruption of a rhoptry-localized homologue of sodium hydrogen exchangers in Toxoplasma gondii. (2005 Mar, Int J Parasitol) PubMed / full text
   more detail about this publication

rhoptry during intracellular tachyzoite
  • "To confirm the localization of NHE2 in the rhoptries, we used the anti-TgNHE2 antibodies to stain Rop4-GFP parasites that express GFP in the rhoptries via a fusion to a fragment of the rhoptry protein Rop4 (Bradley et al., 2004)."
  • Microscopy type: Light
  • Microscopy method: GFP tag
  • Strain: RH HPT-
  • Gene model mapping comments: inferred from another publication
  • Localisation record: rhoptry during intracellular tachyzoite
  • Other genes localised in this publication: sodium/hydrogen exchanger, putative

Bradley, P. J., Li, N., Boothroyd, J. C.
A GFP-based motif-trap reveals a novel mechanism of targeting for the Toxoplasma ROP4 protein. (2004 Sep, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

rhoptry during intracellular tachyzoite
  • "GFP fluorescence (green) and colocalization with anti-ROP1 antibodies (red) showing GFP is trapped in the rhoptries of Toxoplasma in clone R1."
  • Microscopy type: Light
  • Microscopy method: GFP tag
  • Strain: GT1
  • Gene model mapping comments: inferred from another publication
  • Localisation record: rhoptry during intracellular tachyzoite
  • Comment: strain information not found
  • Other genes localised in this publication: nucleolar phosphoprotein nucleolin, putative

Carey, K. L., Jongco, A. M., Kim, K., Ward, G. E.
The Toxoplasma gondii rhoptry protein ROP4 is secreted into the parasitophorous vacuole and becomes phosphorylated in infected cells. (2004 Oct, Eukaryot Cell) PubMed / full text
   more detail about this publication

rhoptry during tachyzoite, parasitophorous vacuole membrane during after tachyzoite invasion
  • "Mature, processed ROP4 is localized to the rhoptries, secretory organelles at the apical end of the parasite, and is secreted from the parasite during host cell invasion. Released ROP4 associates with the vacuole membrane and becomes phosphorylated in the infected cell."
  • Microscopy type: Light, EM
  • Microscopy method: Monoclonal antibody directly to protein
  • Strain: RH
  • Gene model mapping comments: Blast from Z71787, gene model inaccurate
  • Localisation record: rhoptries during tachyzoite, PVM during after tachyzoite invasion
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_29109

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • TGME49_075300 Rhoptry kinase family protein ROP2B (incomplete catalytic triad)
  • NCLIV_001950 Rhoptry protein ROP7 (EC 2.7.11.12), related
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>TGME49_095110 Rhoptry kinase family protein ROP4 / ROP7 (incomplete catalytic triad) ***WARNING: GENE MODEL INACCURATE ***
MQFEATDQATGEPMTALVGHTVLEATARDVDSMRNEGLAVGLFQKVKNPYLANRYLRFLAPFDLVTIPGKPLVQKAKSRN
EVGWVKNLLFLLPPTHVDMETFVDEIGRFPQEDRPLADAARLYLTVQAVRLVAHLQDEGVVHGKIMPDSFCLKREGGLYL
RDFGSLVRAGAKVVVPAEYDEYTPPEGRAAARSRFGSGATTMTYAFDAWTLGSVIFLIWCSRAPDTKSGYEYSVEFFFSR
CRRVPENVKLLVYKLINPSVEARLLALQAIETPEYREMEEQLSAASRLYSAAAFLVLGLCLVQQGAGIQRPHQWKSSEAA
LSVSPAGDIVDKYSHDSTEGENTVSEGEAEGSRGGSWLEQEGVELRPPLLDSQTGTSTASPTGFRRFLRRLRFWRRGSTR
GSDDAAEVSRRTRVPLHTRLLQHLRRVGRFFRHGIPAAAGRFFRRVWPERPQPVFTEGDPPDLETNSLYYRDKVPGEVII
REVLGKVAGFGPTSGHGVFAAYENAFSEMLWAEGGAVTVISELGRPGRQLVRGNLINIVDGGLLFQATDQATGEPMTVLV
GSTWNKPSGKDLDKLRHQALAIGLFQKVKNPYLANRYLRFLAPFDLVTIPGKPLVQKAKSHNEVGWVINLLLLLPAIEID
MGRFVEELYELPTEDRPLADAARLYLTVQAVRLVAHLQDEGVVHGKILPDSFCLKREGGLYLRDFGSLVRAGTKVVAENA
QGFSPPEVRGSRGGLLFGPRKTQMTHGMDAWGLGATIFFIWCFKAPTTGPEEEYSIEFLFSLCRRAPENVKLLVYKLINP
SVEARLLALQATETPEYREMEEQLSAASRLYSGDGTPPNMGHPTSFGQPSCLVWLAAAFLVLGLCLVQQGAGIQRPHQWK
SSEAALSVSPAGDIVDKYSHDSTEGENTVSEGEAEGSRGGSWLEQEGVELTSRLLDSQAGS

Gene-Specific Links for TGME49_095110

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins