ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_094690 (ROM5) *

* The amino acid sequence is recorded as differing between ApiLoc and the genome database. See the gene model mapping comments in each localisation for more information.

rhomboid-like protease 5, a gene from Toxoplasma gondii

Compiled localisation
posterior during intracellular tachyzoite
parasite plasma membrane during extracellular tachyzoite

Who localised this protein by microscopy?

Brossier, F., Jewett, T. J., Sibley, L. D., Urban, S.
A spatially localized rhomboid protease cleaves cell surface adhesins essential for invasion by Toxoplasma. (2005 Mar 15, Proc Natl Acad Sci U S A) PubMed / full text
   more detail about this publication

posterior during intracellular tachyzoite, parasite plasma membrane during extracellular tachyzoite
  • "(C) TgROM5 (aHA9) was localized mostly at the posterior end of intracellular parasites (Top). In extracellular parasites, TgROM5 appeared to be distributed along the surface of the cell in patches (Middle and Bottom). After treatment with ethanol to induce microneme secretion, TgROM5 was often colocalized with MIC2 at the extreme posterior end (arrow). (Scale bar: 1.0 um.) (D) CryoimmunoEM labeling by using anti-HA9 antibodies revealed that TgROM5 was localized in patches at the surface of the parasite."
  • Microscopy type: Light
  • Microscopy method: HA tag
  • Strain: RH hxgprt-
  • Gene model mapping comments: Blast from AY587208.1, gene model inconsistent
  • Localisation record: posterior during intracellular tachyzoite, patchy surface during extracellular tachyzoite
  • Other genes localised in this publication: rhomboid family domain-containing protein, rhomboid-like protease 4, microneme protein 2

Orthology

OrthoMCL

Part of OrthoMCL group OG4_114081

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>TGME49_094690 rhomboid-like protease 5
MSSKGGSSRLGSKDLKKMTSRTERELRDSGRVRGEVERVEKRLRATAKVKEQPPTGDYKRRALASPGETAAPTFLVDSRG
IPRKTSSTAPRKATLRPASSSPRLASSSRPTESTLPSSSSRALQGASSSSSSRPRRLHESASGRGGSGGSAGELRQEKKR
LPELEAAEAAPASCVVELRDVTARKGRTSPATPPETAGSSVCGQGSHARTAEKLEEGTASHRDGSRRGSVDAETWATPGD
GSSSHEFESSPQREERMQPQETGRRELSSEPRSGDLTKNGGDGGPRRHSCAWRKWREHMIQSFDITTHPFPPRGDGSPRR
GKFLMIFLTSSVLFFVFLQELVLNVTTFNGRCMSPVLYPSHDAPESERTPRVISFGYGACEHNLGVSLFRREETKKDPRG
RWTPGPLTERCASGRCASDDGWPSDLVQRGRAQRSPAAFDSPNPRVFSSLGALDTNKVRNYGEMFRVVWGMFLHGGWMHL
LLNVSCQAQTLWILEPAWGFLRTLSLWIVGGVSGSLLSAVANPCTVTVGSSGAFYGLLGALVPFSIEYWDHIASPAWFLF
CVSVLVMVAQFGNMVGVQGVDNNAHLGGLIGGLLFGFATIRSVHAFRWQGVAERMASSTLFWWMFPAEKRRSLREDNLQR
VAREREERSSGRIPPPKFVWKFRGHEREWCVRFAAAVGLVTFWSVLWLYLLVPSYYESLSSPPGNFSFLGSTGCHCCRVQ
PFPGEEDKLPAFHPVRVNRGLFWCFVSEGVANLFCGRSSALNRGADVYGQTRQFEEALGDLPSARAGEAPLRIAKEEGES
ASVWQRLVKSAKKTYNAVLGNTTTPAAPSAAELAQQTRAGQ

Gene-Specific Links for TGME49_094690

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins