ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_094670 ()

eukaryotic translation initiation factor 3, putative, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_11918

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • MAL8P1.83 eukaryotic translation initiation factor, putative
  • PBANKA_071520 eukaryotic translation initiation factor, putative
  • PY00540 eukaryotic translation initiation factor 3 p42
  • PVX_089625 eukaryotic translation initiation factor 3 subunit 4, putative
  • PCHAS_072430 eukaryotic translation initiation factor, putative
  • PKH_051690 eukaryotictranslation initiation factor, putative
  • TGME49_094670 eukaryotic translation initiation factor 3, putative
  • NCLIV_001570 Eukaryotic translation initiation factor 3 subunit G-2, related
  • cgd4_1030 eukaryotic translation initiation factor
  • Chro.40123 eukaryotic translation initiation factor
  • CMU_015200 RNA recognition motif. family protein
  • TP01_0314 eukaryotic translation initiation factor 3 subunit 4, putative
  • TA21285 eukaryotic translation initiation factor (eiF3 delta homologue), putative
  • BBOV_IV004370 translation initiation factor 3 subunit, putative
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_094670 eukaryotic translation initiation factor 3, putative
MAAERKWADFELDDDYELGDLVNTATGFETKPDEEGVKTVTTYTQTLRGETLKVTKRIKVIRKCQRINKDVYARKNIVPF
GLDAADGDPSLSATTVRSHEEIIIEVPRSSKQRKFKEEEEEDDFYMGDLNPSKTSRDLRQKFRALREDDEAGAAGGDGDE
ETGLRSAGAGKYIPRARREGETLKDVENRRREECTIRVTNLSEDVKDEDLTELFGKIGKIDRIYLAKHKEKKCSKGFAFI
TYQRREDAVRAIRQLNRHGYDNLLLNVEWAKPSNRDR

Gene-Specific Links for TGME49_094670

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins