ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_094620 ()

eukaryotic translation initiation factor 3 subunit 8, putative, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_11480

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • PFL0310c eukaryotic translation initiation factor 3 subunit 8, putative
  • PBANKA_060480 eukaryotic translation initiation factor 3 subunit 8, putative
  • PY00916 eukaryotic translation initiation factor 3 subunit 8
  • PVX_084345 eukaryotic translation initiation factor 3 subunit 8, putative
  • PCHAS_060660 eukaryotic translation initiation factor 3 subunit 8, putative
  • PKH_130480 eukaryotictranslation initiation factor, putative
  • TGME49_094620 eukaryotic translation initiation factor 3 subunit 8, putative
  • NCLIV_001520 Eukaryotic translation initiation factor 3 subunit C, related
  • cgd4_3770 conserved hypothetical protein
  • Chro.40430 eukaryotic translation initiation factor 3 subunit 8
  • CMU_018830 eukaryotic translation initiation factor 3 subunit 8 family protein
  • TA10240 eukaryotic translation initiation factor 3 (subunit 8), putative
  • BBOV_III008380 eukaryotic translation initiation factor 3 subunit 8, putative
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_094620 eukaryotic translation initiation factor 3 subunit 8, putative
MQSKFWAAASDESEDSGFSSSESEAEQEQQVPAGEARRPVVASRWAAADTSSSDDEGGRVVKSLKDRRWTAMRETIRQMR
NHMKIADFSELYKDYESLVRCLQKSQQIVEQEGLPSFFVRIIVELEQFLEERHRDKEAFKKLSKAKATAFNTLRAKVRKT
NEQWQEKVDACKADPSQFASSDSDDDDDFDSDDSSDLSDISDSSESEESDEEKPKRKAMNEDGSEDSEDSEWSDSDASSL
SSGEETDKHKAAMAKWGLRSEGDKSRKQKEKKKTKRISKTKDEGALSPRGEAGAEFSIKDMESLFDTNDLDASVIRKRVQ
LVVEKRGRRGVDRLEQTRILKRLAELAARVGPQSELEVLAHLISAEFDTTSGVFACLSSAIWLDVFHQLEAVLGHLEEGV
KKARADGKGAGGTAYVLVPTVLASSDAVDAALVAPDAQVVSSGILTSFVERLDDELMKSLQFTDVHSEEYKERLGQSVDM
IAVLCRAWVHLTDCQSKPQAATLALRINEHMHYKHDAIAASMWDLVRKRVPAEVAQHLPDEGMKPSDFVEKLTNLVFESE
SSRERTRALLHLAYSRALHDDFYKARDLLHTPNMQELALQTDTQTQILYNRDLVQLGLCAFRNGRINEAHACLSEVCPKH
KELLAQGLSNLKNVECTPEQERAEKRRLLPYHMHISMELIEGAHNICAMLIEVPHMAHDPFEHRKRPISKHFRRMLETYD
KQAFLGPPENARETVMAATKALQKGDWKECCRFIFSLGIWEKLMNATEIQEMLKLKVKQEAMRTYIFTYLTLYDSFSISQ
LCGMFELPESTVHSIVSKMMINEEIHASWDESSQFILISRVERTRLQQLASTLTENVNNAVEQNELTLNMKNPKCAATGR
ATDSAGAAESAKGTGAREARGAGASGAAGAEASDPVGAQGEGAGGAVGAAFAPALEVGWVNARAGTGLEPAEIDGVQGKS
IKLGGCFVCLELRDGGENLRWVCRASVRVHVEMWALPEDLQRRWETGVCSFCGSVECHVSTSSFVYGCGVTLIHFVNPVR
GLGCQRQVTFAKMRASPLLRPKGGSFRLVVSGEAEVEVTCICTSMYAWSCVHTFRCRNISLFVF

Gene-Specific Links for TGME49_094620

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins