ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_094290 (Der1-1ER)

der1-like family domain-containing protein, conserved, a gene from Toxoplasma gondii

Compiled localisation
endoplasmic reticulum during 24 hours after tachyzoite infection

Who localised this protein by microscopy?

Agrawal, S., van Dooren, G. G., Beatty, W. L., Striepen, B.
Genetic evidence that an endosymbiont-derived endoplasmic reticulum-associated protein degradation (ERAD) system functions in import of apicoplast proteins. (2009 Nov 27, J Biol Chem) PubMed / full text
   more detail about this publication

endoplasmic reticulum during 24 hours after tachyzoite infection

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10505

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_094290 der1-like family domain-containing protein, conserved
MDPLPHGVGSGGGYPSNGPEAWFFSLPPVTRAVTCITFACTLLSSIELMPARLLILDWELVFQKLQVWRLLTNVLYIGRF
SLGWVLHMYMWTQVSSDLENNAVFVQASKGAYLYFIVLQTLCLDCISLLLFWPTGLHLLGGSLLFAVLYYWSRRESYTPV
SIYFLTVQGHQLPFVLLLLHLLMGKDLWSDAIGLLSGHIYYFFREILPAQGGADLLSYTPKMFDRLAERLSNRPEVGRRP
AANRTGTASTGAGGGGPGGPGGSTWGGSVRPRPAAGGSGTQAFSGRGYRIGSD

Gene-Specific Links for TGME49_094290

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins