ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_094270 (CARM1)

arginine methyltransferase protein, putative, a gene from Toxoplasma gondii

Compiled localisation
nucleus during tachyzoite

Who localised this protein by microscopy?

Saksouk, N., Bhatti, M. M., Kieffer, S., Smith, A. T., Musset, K., Garin, J., Sullivan, W. J. Jr, Cesbron-Delauw, M. F., Hakimi, M. A.
Histone-modifying complexes regulate gene expression pertinent to the differentiation of the protozoan parasite Toxoplasma gondii. (2005 Dec, Mol Cell Biol) PubMed / full text
   more detail about this publication

nucleus during tachyzoite
  • "Ectopically expressed HA-FLAG-TgCARM1 is able to localize to the parasite nucleus, consistent with a role in transcriptional regulation"
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: RH
  • Gene model mapping comments: Blast from AY820755.1, annotation matches
  • Localisation record: nucleus during tachyzoite
  • Other genes localised in this publication: histone deacetylase, putative, transducin beta-like protein 1 (TgTBL1), histone H3

Orthology

OrthoMCL

Part of OrthoMCL group OG4_15299

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_094270 arginine methyltransferase protein, putative
MSPSNSSSAAQDAHRAAELPIDVGDVTSFCCTVFPFELDSMQFVRGAVHQMINNSRRFSGGQVRVDFLRAGGHPTVSFPL
PPGEGKAEVPLAHVQRLSMKTALCCPLATDTTGGYSAVAAGRTGKLPGQAAKGISSGTDADAASEFDAVFGLEFKDEATA
NAFFTEWSRVRSPATLGSAEVSPASASAARTKEQRKRMGGHMGDMDASVVETYFQYYGKMANQMNMLQDTVRTTTYQRAI
VENRADFEGKTVMDVGAGSGILSFFAAQAGAKKVYAVEASNMAATIALLCKGNPSLGSRIQIINKPLESIEDSEVPEKVD
VLISEPIGTLLFNERMIETYLSARDRFLKPGGKMFPSKSSLYIAPFVDYVLHSDMMNKCNFWKQTQFCGVDLSNALEVAV
VEQFRQPVVDYIDPSLLLAPPHQKEFDFTKISRESLEEITVDFSFTVNSPTLVHGVAGWFDVCFDGSEKVISFTTSPQSP
PTHWFQTRVVLRHPLAVNPSQPVLGRMSMRGNKQQSYFVDVLLALQDCPVSTSAKNVDLKDPDYRYYTNPSHSYFPNCQQ
MGFQTTQMPASVPTENASSASFVSSSHSPCVSNVASEAGAPNSVAGCEEAREAVQGEKKKFSSPWSEHTGARAGRDEGSM
SIDAGVVEANDEIHRVFSGR

Gene-Specific Links for TGME49_094270

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins