ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_094190 ()

hypothetical protein, conserved, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_30353

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • PF10_0167 enoyl-CoA hydratase-related protein, putative
  • PBANKA_050150 conserved Plasmodium protein, unknown function
  • PY00201 Drosophila melanogaster CG5044 gene product
  • PVX_001730 hypothetical protein, conserved
  • PCHAS_050160 conserved Plasmodium protein, unknown function
  • PKH_060130 hypothetical protein, conserved in Apicomplexan species
  • TGME49_094190 hypothetical protein, conserved
  • NCLIV_000930 3-hydroxyisobutyryl-CoA hydrolase/ catalytic, related
  • TA03560 hypothetical protein, conserved
  • BBOV_IV007650 conserved hypothetical protein
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>TGME49_094190 hypothetical protein, conserved
MYIYIYIYIYASLFCLCSASGVLNMKGLCGLFRKLRDLEVNPLKRFVVLTSRHRHFFSTGFDLKELLFLAELTQKSTEKT
IPLVALWQLRNLCDVAYLVHNYTKPLIVLMNGATAYGWIPDSGMSFVLANLRGSLGVFLALTGHTLSGPDLIWSGLCKHW
ISPEALPFLELTAEKQLEVSEREAAVLLEEHFLDAPDAYSLDDWEEVIHEHFDAPTVAEVRARLKATASRQSTSVEGQLH
AAWARAVLDRLARRSPLAADVTFALIRTVQQLKKQIIQDAGIFRSEWHKIRRTGLSVPFTLQGDCRKQILEAVEDRLVQE
ALQLELRAALRLLAWSTDTIDGLRSECAGRLNPEYAYRPQWKQSQRFHKESYLTPLQDFFPTISSSRDAASHRAGPHISP
SCAYFFPTPEFTVTPRTFFPLSAHPLIRRIHPDFDEETGNDHNPYAMHKLQMQWNHSLFIQERMQALRHFRNVANV

Gene-Specific Links for TGME49_094190

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins