ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_093690 (PRF)

profilin family protein, a gene from Toxoplasma gondii

Compiled localisation
acrosome and cytosol during tachyzoite

Who localised this protein by microscopy?

Plattner, F., Yarovinsky, F., Romero, S., Didry, D., Carlier, M. F., Sher, A., Soldati-Favre, D.
Toxoplasma profilin is essential for host cell invasion and TLR11-dependent induction of an interleukin-12 response. (2008 Feb 14, Cell Host Microbe) PubMed / full text
   more detail about this publication

acrosome and cytosol during tachyzoite
  • "The presence of TgPRF was detectable in the acrosomes; however, it did not appear to be a specific enrichment since cytosolic YFP was also detectable."
  • Microscopy type: Light
  • Microscopy method: YFP tag
  • Strain: RH
  • Gene model mapping comments: Blast from AY937257.1
  • Localisation record: acrosome and cytosol during tachyzoite
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_23358

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>TGME49_093690 profilin family protein
MSDWDPVVKEWLVDTGYCCAGGIANAEDGVVFAAAADDDDGWSKLYKDDHEEDTIGEDGNACGKVSINEASTIKAAVDDG
SAPNGVWIGGQKYKVVRPEKGFEYNDCTFDITMCARSKGGAHLIKTPNGSIVIALYDEEKEQDKGNSRTSALAFAEYLHQ
SGY

Gene-Specific Links for TGME49_093690

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins