ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_093190 ()

endonuclease/exonuclease/phosphatase domain-containing protein, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_22017

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • PF11_0122 endonuclease/exonuclease/phosphatase family protein, putative
  • PBANKA_093600 inositol-5 phosphatase, putative
  • PY03723 hypothetical protein
  • PVX_091230 endonuclease/exonuclease/phosphatase domain containing protein
  • PCHAS_090830 inositol-5 phosphatase, putative
  • PKH_090890 conserved Plasmodium protein, unknown function
  • TGME49_088800 endonuclease/exonuclease/phosphatase domain-containing protein
  • TGME49_093190 endonuclease/exonuclease/phosphatase domain-containing protein
  • NCLIV_000140 Inositol-1,4,5-trisphosphate 5-phosphatase 2 (EC 3.1.3.36), related
  • NCLIV_041220 hypothetical protein
  • TP01_1143 hypothetical protein
  • TA16560 inositol phosphatase, putative
  • BBOV_IV011630 hypothetical protein
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>TGME49_093190 endonuclease/exonuclease/phosphatase domain-containing protein
MEYEESSTREGSETHETTPYGSKGARRSAELPECCLANLVVDALFPDEDPAERARPETAKVAQEPPHGACLALSDRGTQA
ELDGTRWECRVVTPLVAVSVDCLSAEGCGVVVCEQPFSFLDYFGCCKVEYPPRYGTFDGELISAGRYASQMLQDAESARQ
RKSPHTVRSDRVEGDALFSAKKEPEVFELVRPEPGKDNRDKTAIPVKIFVGTWNTEYQEFENHGPKSEERFCKTAKWLVD
CKLKKEGVRKISKEESFYSGNSNSLRDNSDVSCEMYDSVTLHVTGEESDNDDVMTTVGEGEEEEEEGGDTKQNTKHLLKF
SMEGHPLRDWIKGGYDVYVVTLQEVTNDSIFQAISEYLESENGETFFRVDMGEGKISGLGKGAWTKMKSTSLACWIRESK
LWPLGPVIPVDSKAFSFTVLNGSKGAVTVTLKVHKQLVCFVGCHLPASAKERGKARAFIRAKLAAMYSSEKNVDFTRVFH
HILWAGDFNFRSQISSKQAMALLRAGKMHELATFDEGALESGKDMEMHGWMEAPVNFLPTYKKADNRPPLDLSRPDWVDQ
EYQSTMKKKGVLGTKVVDRPPSWCDRIFRWSPQELHYNLIAPPDQYFAAQPEFPNILMASDHAPVGGGFELYPLDKRFQV
PLTFMADPSEALEAGDMRYGARNSLIADCGGRPDHLKMKSTV

Gene-Specific Links for TGME49_093190

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins