ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_091930 () *

* The amino acid sequence is recorded as differing between ApiLoc and the genome database. See the gene model mapping comments in each localisation for more information.

nucleolar phosphoprotein nucleolin, putative, a gene from Toxoplasma gondii

Compiled localisation
nucleus during intracellular tachyzoite

Who localised this protein by microscopy?

Bradley, P. J., Li, N., Boothroyd, J. C.
A GFP-based motif-trap reveals a novel mechanism of targeting for the Toxoplasma ROP4 protein. (2004 Sep, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

nucleus during intracellular tachyzoite
  • "GFP fluorescence shows nuclear staining with a single bright spot in each nucleus (white arrowhead). Colocalization with Hoechst staining confirms the nuclear localization of the fusion protein"
  • Microscopy type: Light
  • Microscopy method: GFP tag
  • Strain: GT1
  • Gene model mapping comments: Blast from MKRKAAPVAVARPA (taken from figure 2), annotation matches, gene model inconsistent
  • Localisation record: nucleus during intracellular tachyzoite
  • Comment: strain information not found
  • Other genes localised in this publication: Rhoptry kinase family protein ROP4 / ROP7 (incomplete catalytic triad) ***WARNING: GENE MODEL INACCURATE ***

Orthology

OrthoMCL

Part of OrthoMCL group OG4_12777

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_091930 nucleolar phosphoprotein nucleolin, putative
MKRKAAPVAVARPASDSDDSDSSEEEQQMKVQKGKKGAAGAPASAKGAPKKPVPSKADSSSSSEDDSSDEEVAKRVAKKG
GVITSASAVQSAKQAVAASKKGAKAKPAADSSDSSGDSTEDETPQSKPVAKGKAQTANAATRKQESSSDDSSDEEAPNGV
RQAAPKAAAKAAVRKAASSSDESSDEDEAPQPPQPKGKKAAQPSKAAAPKAASKKAAETSSEEDSSDDEPAKKVTPPASK
KPAAKAASSDDDSSSDEEMPAPQARPQKPAAGKAAAQKKADSSESEEDSDSDDEPSAKSKVSAAARLPAKKPVAKKEESD
SSDEDDSSDDEKPAPAAQKKAVAAAQPKKKAAKAPAASSDESDEDDSDEEEEAPKKSKNEKDVMMEEESDEDSDDEEKSE
RPVKKRKEAPADEDLQHTSKKRKEEHPKARLQTKGGGVVDKLRTEIFCGGLPYSTTESELKELFESDCGPTTRIKMLEGK
GIAFITFETEEAAQKAVEYNNTQYNGRTLRINLTADKQNHQPGGGDRGGRGGRGGRDQGNGRGGGAAGGDRPKASPNKQI
VVRNLSFNATEESIRSLFEECGEIQEVRMPVFEDTGKFKGQAFIEFDSIESATKAVEYNNTDVDGRTVWIDFALPRGSGG
GGRGGFGGRGGGRGGFGGGRGGGRGGGRGGRGGGRGGASSAVKAAKDGTVQEFQGTSKTFDSDSD

Gene-Specific Links for TGME49_091930

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins