ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_091890 (MIC1, Mic 1)

microneme protein MIC1, a gene from Toxoplasma gondii

Compiled localisation
microneme during bradyzoite and tachyzoite

Who localised this protein by microscopy?

Reiss, M., Viebig, N., Brecht, S., Fourmaux, M. N., Soete, M., Di Cristina, M., Dubremetz, J. F., Soldati, D.
Identification and characterization of an escorter for two secretory adhesins in Toxoplasma gondii. (2001 Feb 5, J Cell Biol) PubMed / full text
   more detail about this publication

microneme during tachyzoite
  • "In wild-type parasites, T101F7 mAb anti-MIC1 and polyclonal anti-MIC4 showed perfect colocalization of the two proteins and a typical apical micronemes staining."
  • Microscopy type: Light
  • Microscopy method: Monoclonal antibody directly to protein
  • Strain: RH
  • Gene model mapping comments: Blast from CAA96466 from 9027753 annotation matches
  • Localisation record: microneme during tachyzoite
  • Other genes localised in this publication: microneme protein MIC4, microneme protein MIC6, SRS29B (= SAG1, P30)

Achbarou, A., Mercereau-Puijalon, O., Autheman, J. M., Fortier, B., Camus, D., Dubremetz, J. F.
Characterization of microneme proteins of Toxoplasma gondii. (1991 Aug, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

microneme during bradyzoite and tachyzoite
  • "In all cases, apical labeling of tachyzoites and bradyzoites was observed by indirect immunofluorescence assay. Immunogold localization on ultrathin sections of bradyzoites or tachyzoites showed a specific labeling of micronemes. The following proteins were characterized using 2-dimensional gel electrophoresis and Western immunoblotting: Mic 1 (60 kDa, Pi 6.5), Mic 2 (120 kDa, Pi 5) and Mic 3 (90 kDa, Pi 6.75)"
  • Microscopy type: EM
  • Microscopy method: Monoclonal antibody directly to protein
  • Strain:
  • Gene model mapping comments: inferred from another publication
  • Localisation record: microneme during tachyzoite and bradyzoite
  • Comment: fulltext not available online
  • Comment: strain information not found
  • Other genes localised in this publication: microneme protein 2, microneme protein MIC3

Orthology

OrthoMCL

Part of OrthoMCL group OG4_115456

Localised Genes in this Group
Other Apicomplexan Genes in this Group
    There are no other apicomplexan genes.
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>TGME49_091890 microneme protein MIC1
MGQALFLTVLLPVLFGVGPEAYGEASHSHSPASGRYIQQMLDQRCQEIAAELCQGGLRKMCVPSSRIVARNAVGITHQNT
LEWRCFDTASLLESNQENNGVNCVDDCGHTIPCPGGVHRQNSNHATRHEILSKLVEEGVQRFCSPYQASANKYCNDKFPG
TIARRSKGFGNNVEVAWRCYEKASLLYSVYAECASNCGTTWYCPGGRRGTSTELDKRHYTEEEGIRQAIGSVDSPCSEVE
VCLPKDENPPVCLDESGQISRTGGGPPSQPPEMQQPADRSDERGGGKEQSPGGEAQPDHPTKGGNIDLPEKSTSPEKTPK
TEIHGDSTKATLEEGQQLTLTFISTKLDVAVGSCHSLVANFLDGFLKFQTGSNSAFDVVEVEEPAGPAVLTIGLGHKGRL
AVVLDYTRLNAALGSAAYVVEDSGCSSSEEVSFQGVGSGATLVVTTLGESPTAVSA

Gene-Specific Links for TGME49_091890

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins