ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_091140 ()

CCR4-Not complex component, Not1 domain-containing protein, conserved, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_11318

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • PF11_0049 NOT family protein, putative
  • PBANKA_094310 Not1 domain containing protein
  • PY01432 hypothetical protein
  • PY01940 similar to KIAA1007 protein-related
  • PVX_090875 hypothetical protein, conserved
  • PCHAS_090120 Not1 domain containing protein
  • PKH_090100 CCR4-Not complex subunit, putative
  • TGME49_091140 CCR4-Not complex component, Not1 domain-containing protein, conserved
  • TGME49_103150 CCR4-Not complex component, Not1 domain-containing protein
  • NCLIV_042980 hypothetical protein
  • cgd6_2060 cdc39p protein-like; C-terminal Not1, CCR4-Not complex component; Not1
  • Chro.60241 transcription regulatory protein
  • CMU_007830 CCR4-Not complex component, Not1 domain-containing protein, conserved
  • TP01_1063 hypothetical protein, conserved
  • TA17090 hypothetical protein, conserved
  • BBOV_IV003100 transcriptional regulatory protein, putative
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_091140 CCR4-Not complex component, Not1 domain-containing protein, conserved
MGDPGGGDSVFPSLKATGSSATGPSTGTSSHSGAGGSTSGNAVSASATSFAGSSTGTGASLGSGSATNNNSGLGTEHNAQ
NGEEGTSGKAPMTGSPTAGGVSCSAASAGEADGVSLRGPPAQAASATGNENGAKNGPPGGGAAGAPVSQAQQLLAVAGKP
AQDFEAEVNSCFQKMYSGIYSVDMVVALLQRLSQAPPGSRDSSLFVSMIRTLFFECRHFPKYPPHELALTAELFGQLIHR
HVLINSGNSLMIALRCVLEAIRKGPTSKMFVFGIAALEQFLDRIFLFPQFLVALASLSELQQQHPHYTHYAQSVLLLIPE
KYHSLVVLDPRIAASLPPMPDLPPVVGVAAAARQAAGTGIGEVTQTSEPPSGSSISTMLPPPHGLQHPVTASIQQQLAAA
AKMMNLSSSPPAAPGNSGSALNLAHNSSLLQGNPVPTPPLAASPTQNVSGNPGSLPGLGQANVPASGTGAVGNKAGLSGL
GNAAGSISHTGTLGGVLGAGALLQGVGLGQVEGLMNDHDITAKLEQPPQWVADQVIAVCNSVCEGNVDDKAESLKDVLTE
EHAPWLTYYIVKSRAAKEPNLHGIFVLFIEKLKLPGLWDAVINMTYDCIHVLLKYVDEAKESSSYRTLLKNLGLWLGSIT
LARNRPLKSKRMDLKQLLFTGYEQGHLVAVLPLVCKILEGIKTSKLFKPPNPWTVAVMSLLAEIHLQPNIRTNLVFEVEV
LFKHLHLNVLEYHNRTDHLTKRSPPPGSADFVVRAAAAGVAPATAASGHLGAAGGGIPPGPQATAGRPGTAAASGGVPGA
VRGTPGSMVGRLPGGASGLSLNAVAAAAALGLGPAGGAGAPGSGADPSSSRLGAQHRRGLQGLGPGALGQLDAASGAHGR
LMEAAAAVASAAAGMGRHGGTSGTGASLGGTPQAGVASGPPVPGVGLQQGPGGAGGNAQNVGATGVGMLQSPNQGEGGAG
PSPDGLEIGGHLRVGSDDGAGGVLALGGGRDGHHLSVGEPGSGAGLMGGPGGGGYGGMGQHGGPPSTHPASWSSSLFQGG
GGVMTPPPHYPHGALLPLLGSLGGSGTEQGSSIGSSGVFQPDRLLQNLSQSVVISPSIALLSIQPNLRPLVPLAVDRAIR
EIISAVVERSVTISCVTTRELVCKDFCMESEESLVKRAAHLMVASLAGSLALVTCREPLRVSLSQNLRQLLQPAASSDCN
DQVLIEQVVQIVSADNLELGCSLIEQAVVEKVLRDIEQTMQPALLVRRQARERGIPFVDTNYINSSRWTLNLPEPVKLRP
VLNNRQLQVYKDFLSIGPLKKMQQDNAGPNSGMMSGSGPHGAQTGGLGAPGSTPGPLQGAGGASAAGGAAQMGLGANSGN
SGLVGASGSVPPHTHQLGAVMGEGPSGAFQGLPGRNLIGPSNASSFLGRENMLHQHLAQQHAARLLGQQQGNKFLASLGH
PQVNAASGPPGGPSLAGAGGANAGQLLVQNTGEGGRVLGSPAGTSVASASIGCGVREPILLQPMGEAHLSTVMARLEDCL
VQLRDVVRDIFTCPPIVPTPSTVDTYSTPAGSQVCALPVPHCATPVLTVFACLPSNHEVFQLILAVSAIAGSCPRVEEVA
PALAHKLIKSVFEGASLAASRTSHNAIRGIDPTGLYMEVFFAVLAALRRQSDVVSKLAGEVLSISCSSATIPPKKSNTTV
AAGLVRYRLVSLAAFDLVLANHLDNGRNVAVLEFILALLKTLLDQKAITPADLPTTFKTLAEAPATTLPAKLVQLKGWQP
LPMAEARTKLVEAFREDQEERKKSPHERLTTMTELMESYYSVNPVRVRSLPCLPVTPQKDRQLITMIFGEWLRFCACVSP
FGGPNGDRGASTLGAQGGAGGGTSGNFGNTDSASLLRATFFQRVSHQGLLRMDEDTDRFFAVCVEEAIARSLRFREDSKS
AAEETSEDGSKAGDKSEGAAGAKCSGENAKGAKAPAGEPEAEAKKDEQKGNVEEAKEEGRAAEESETMSRAADREEASKP
GKGATSLAAKNEKSEGEKEPSSEAGEKGALGPSQAGGRRLSAGLASCPILEYDSATVTPESLTAMQTPPEETEPLLDLTP
LDAMAKMIVGMMRLVDPVQISPVMILQRALGIVCRHIHMEAERLGPAFNQRPYYRLLLAILLEITAPATKDGNGSGGAQA
GASGASGSDGKAVLGGGVSESQVLPSLLSFAEHLALLSPTRVPAFAFAWLGLVGHRLFMPRLLKSGRGWATLHRLLLLHL
EFLQPLLRNVALSDSIRLLYKGALRILLVLLHDFPEFLCEYHFSFCDVLPLNCVQLRNVVLSAFPRNMKLPDPFLPNLKV
DLLADIKTVPRILSSFTVTLLQKGLKKDIDAFWQTRDAALLPQMKAKFLVDRESAVRIGTKYDVSLLNAFLLYVGTGVPE
RVGASDGPALIMDAMLGIASLGGASGARGELSPSLEILLYMSKELDMEGRYLLMSALANHLRYPNAHTHYFSCVLLWLFG
ESRDELIQEQITRVLLERLIVHRPHPWGLLITFIELIKNPRFNFWSCSFVSAAPEVEKLFQSVAHTCLGQSGAQQLQQQR
RR

Gene-Specific Links for TGME49_091140

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins