ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_091040 (LDH2)

lactate dehydrogenase, a gene from Toxoplasma gondii

Compiled localisation
cytoplasm and not nucleus during bradyzoite
during bradyzoite and not enteric and not merozoite and not tachyzoite

Who localised this protein by microscopy?

Ferguson, D. J.
Use of molecular and ultrastructural markers to evaluate stage conversion of Toxoplasma gondii in both the intermediate and definitive host. (2004 Mar 9, Int J Parasitol) PubMed / full text
   more detail about this publication

during bradyzoite and not merozoite and not tachyzoite

Ferguson, D. J., Parmley, S. F., Tomavo, S.
Evidence for nuclear localisation of two stage-specific isoenzymes of enolase in Toxoplasma gondii correlates with active parasite replication. (2002 Oct, Int J Parasitol) PubMed / full text
   more detail about this publication

cytoplasm and not nucleus during bradyzoite, during not enteric and not tachyzoite

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10365

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_091040 lactate dehydrogenase
MTGTVSRRKKIAMIGSGMIGGTMGYLCVLRELADVVLFDVVTGMPEGKALDDSQATSIADTNVSVTSANQYEKIAGSDVV
IITAGLTKVPGKSDKEWSRNDLLPFNAKIIREVAQGVKKYCPLAFVIVVTNPLDCMVKCFHEASGLPKNMVCGMANVLDS
ARFRRFIADQLEISPRDIQATVIGTHGDHMLPLARYVTVNGFPLREFIKKGKMTEAKLAEIVERTKKAGGEIVRLLGQGS
AYYAPALSAITMAQAFLKDEKRVLPCSVYCQGEYGLHDMFIGLPAVIGGGGIEQVIELELTHEEQECFRKSVDDVVELNK
SLAALG

Gene-Specific Links for TGME49_091040

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins