ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_090980 ()

aminotransferase domain-containing protein, conserved, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10714

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • PF14_0155 serine C-palmitoyltransferase, putative
  • PBANKA_102700 serine C-palmitoyltransferase, putative
  • PY00385 probable glycine C-acetyltransferase, putative
  • PVX_085665 8-amino-7-oxononanoate synthase, putative
  • PCHAS_102780 serine C-palmitoyltransferase, putative
  • PKH_133150 glycine C-acetyltransferase, putative
  • TGME49_090970 serine palmitoyltransferase, putative
  • TGME49_090980 aminotransferase domain-containing protein, conserved
  • NCLIV_042840 hypothetical protein
  • NCLIV_042850 Pyridoxal phosphate-dependent acyltransferase (EC 2.3.1.29), related
  • CMU_016830 8-amino-7-oxononanoate synthase protein, putative
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_090980 aminotransferase domain-containing protein, conserved
MASGATYFTRGTGSPFLGAGVEWASNIDLFLCAFLSASVLGILLAFFNDEVSWGSLRWSWIATQLLPITPCSSHAVYKDV
ETALAKAARNKAGSKRALEEFLAALQDGTVMVLLSKWSARGFERLAFYWQALKIKYTAQSRRQFFYQMQKVQLKLEIKPG
ETEMQSYNDAKRYMKSRDLWPFAYEVSNVKDTQVICEGVRAYPMSSYSYLDFVREPLVQEAALAAGRTWSTGNHGARMLG
GNMRILRDLEKMVGRFFGREDSLLCATGFLATMSSICAVAKEGDLIVGDNRLHASLRSGMKLSGAKEMLFRHNNWHHLQQ
TLAKHRRKYKNCWIVIESVYSMDGDIADLPVVRRLADQYNCRILLDEAHGLGVLGKTGRGLEEHFNMPGAADVIVGTFSK
SIGGVGGYITGDNDLVEFLDFHAPGSVFSAPLTAYSAGGAMMAFELMQGEQSWRIAKAQENAKYLRHALQTGLGLWPKDY
PAERKFELEGVACTTVIPVVFPHDGDRVFRVTQAMLKRGWMVAAAAYPACPLNRPRIRVTATAAYNQKMMDEFVKSLVEV
TVECPPTDMLR

Gene-Specific Links for TGME49_090980

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins