ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_090670 (LAP)

cytosol aminopeptidase, a gene from Toxoplasma gondii

Compiled localisation
cytosol during tachyzoite

Who localised this protein by microscopy?

Jia, H., Nishikawa, Y., Luo, Y., Yamagishi, J., Sugimoto, C., Xuan, X.
Characterization of a leucine aminopeptidase from Toxoplasma gondii. (2010 Mar, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

cytosol during tachyzoite
  • "The cytosolic localization was also confirmed by staining the transgenic parasites with an anti-HA monoclonal antibody (Fig. 3B). "
  • Microscopy type: Light
  • Microscopy method: Monoclonal antibody to HA tag, polyclonal antibody to whole protein
  • Strain: RH
  • Gene model mapping comments: taken directly from publication, blast from primer ata gaa ttc tat gtc gag ggt tcc tgcg
  • Localisation record: cytosol during tachyzoite
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10695

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_090670 cytosol aminopeptidase
MSRVPAPLTVVKTDPTAIPFVGCQPAKKVRMEAVDISEAEKYSGDLIVFSVLAPGCFHDAPNASQPQKGPIALPELAQKF
DDAVGQGMLKDAVEAADFKAKMGSQVFVRLPSKSAPAVKQLAALGFGSIAEVTPSAVTKAAAAFASMLLRGSGEKAKTVA
VVLPTCQKVCPSAEGQRKTREMKERVVTSFLETLLVELQPDLRFKGDREDGKHSGPQVEKLTLFTDDVEAVNRAIARAKV
VAPGVYFAQELVNAPANYCNPVTLARAAVEMAKEAGLEAEVLQQDDIEKLKMGCYLAVAKGSLFPPQFIHLTYKSSNPKR
RVAFVGKGICFDAGGYNLKTGGAQIELMKFDMGGAAAVLGAARALGELKPENVEVHFLVAACENMISAKSYRPGDVITAS
NGKTVEVGNTDAEGRLTLADALVYAEKTVKADTIVDVATLTGAVIVALGYKYAGLWSNKECLASSILKSAENSGECMWHM
PLAKDYAEALDSKCADMNNVGGKGKGGSIIAAVFLNKFIEQASWAHIDIAGTAWDMKTSMATGFGVRTLVEYIMDISTQT
KEN

Gene-Specific Links for TGME49_090670

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins