ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_090660 ()

polypyrimidine track-binding protein, putative, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_11129

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • PFF0320c polypyrimidine tract binding protein, putative
  • PBANKA_010520 polypyrimidine tract binding protein, putative
  • PY01048 neural polypyrimidine tract binding protein
  • PVX_113495 polypyrimidine tract binding protein, putative
  • PCHAS_010580 polypyrimidine tract binding protein, putative
  • PKH_114270 polypyrimidine tract binding protein, putative
  • TGME49_090660 polypyrimidine track-binding protein, putative
  • NCLIV_042650 GG11844, related
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_090660 polypyrimidine track-binding protein, putative
MEEKTTTAPPESFRVVLASVTNLLYPVDIDLIHYLFSKYGEIEKIVTFSKSPTMYQALIQFQSPDQARHALMNLHSRNIY
DGCNTLQIQPSRLNELVVKNNTQKSWDYTVQSGGPSGSVGATGDLPPPGQAPGAAVPAGVNNGRNVGPGPAPHHPGPHGP
PGPYGAGAQHPPMGGAVAGIQPPPPAHAIGHHAAPVHHGVRLGAAGPLGMSHPYHPGSNLLHLLDKLPRELREIESTNPT
QTPVIIVYNLPANITVHMLFNLFSLYGSVLRVKILREKSDTALIQYSDPLYATIAHNYIQGANVLGQSLQVGFSKNMEVK
LPPPNSQKTEATAEEEKRTVAFSIKDQRYGGDDVEKYVKGSCRPTKTIFVANLDENATDEEVQKLFKEHGQVSKFTFKAP
KNESAKTQMAMMEMGTEAEAVAAVMYLHNHELHGRSMKVAFSKTVL

Gene-Specific Links for TGME49_090660

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins