ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_090600 (Succinyl-CoA-synthetase alpha (SCSa))

succinyl-CoA ligase alpha subunit, putative, a gene from Toxoplasma gondii

Compiled localisation
mitochondrion during tachyzoite

Who localised this protein by microscopy?

Fleige, T., Pfaff, N., Gross, U., Bohne, W.
Localisation of gluconeogenesis and tricarboxylic acid (TCA)-cycle enzymes and first functional analysis of the TCA cycle in Toxoplasma gondii. (2008 Aug, Int J Parasitol) PubMed / full text
   more detail about this publication

mitochondrion during tachyzoite

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10538

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • PF11_0097 succinyl-CoA synthetase alpha subunit, putative
  • PBANKA_093850 succinyl-CoA synthetase alpha subunit, putative
  • PY05049 Succinyl-CoA synthetase alpha subunit
  • PVX_091100 succinyl-CoA synthetase alpha subunit, putative
  • PCHAS_090580 succinyl-CoA synthetase alpha subunit, putative
  • PKH_090570 succinyl-CoA synthetase alpha subunit, putative
  • NCLIV_042590 2-oxoglutarate dehydrogenase E1 component, related
  • CMU_040940 succinyl-CoA synthetase, alpha subunit, putative
  • TA10625 Succinyl-CoA ligase [GDP-forming] alpha-chain, mitochondrial precursor
  • BBOV_III007780 succinyl-CoA synthetase, alpha subunit family protein
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_090600 succinyl-CoA ligase alpha subunit, putative
MAASILRAAQNGVIFRHLKTSEITQRWSSTARVFVDKNTKVICQGLTGKQGSFHTEQCLAYGTQFVGGVNPSKKGSTWQS
SDGKFSLPVFGTVKEAKEATGCDASMIFVPPPFAAQAIMDCIAEEIPLAVCITEGIPQQDMVRVKQALLSQNKTRLIGPN
CPGIIKPGECKIGIMPGYIHAKGKIGVVSRSGTLTYEAVNQTTQTGLGQSTCVGIGGDPFNGTNFIDCLERFVNDPETKG
IVLIGEIGGSAEEEAAAWLKEHNKEQKPVVSFIAGLTAPPGRRMGHAGAIVSGGKGTAEGKIAALEDAGVHVVRNPAAMG
QKMLEVMQAAGLH

Gene-Specific Links for TGME49_090600

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins