ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_090170 ()

protein serine/threonine phosphatase, putative / sortilin, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_15994

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • PF14_0630 protein serine/threonine phosphatase
  • PBANKA_132950 protein serine/threonine phosphatase, putative
  • PY06605 protein serine/threonine phosphatase alpha
  • PVX_117160 protein serine/threonine phosphatase, putative
  • PCHAS_133410 protein serine/threonine phosphatase, putative
  • PKH_123950 protein serine/threonine phosphatase, putative
  • TGME49_090170 protein serine/threonine phosphatase, putative / sortilin
  • NCLIV_042420 Serine/threonine protein phosphatase (EC 3.1.3.16), related
  • cgd3_250 protein serine/threonine phosphatase alpha
  • Chro.30038 protein serine/threonine phosphatase alpha
  • CMU_038520 serine/threonine protein phosphatase, putative
  • TA08350 serine/threonine phosphatase, putative
  • BBOV_II001630 kelch repeat domain containing/Serine/threonine protein phosphatase protein , putative
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_090170 protein serine/threonine phosphatase, putative / sortilin
MNQLHENGLPGLPSASAAPVGSSSAGNPAGKSEFLGVPKSIQQTGDVPPPRFGHTCTCVGNHKVVVFGGAVGSAGGYSIT
NESYLFDITGCRWHHLFAENPPPPRAAHAACCVDTLQLVVFGGATGGGSLSAEELYLLDLRKDPELQWMPVPLQGITPGR
RYGHSMVYNKPNIIVFGGNDGERPLADVWFMDVEKSPFRWEEVVFEAQARRPPPRVYHATEVCREGPASGMMVVFGGRST
SSRSLNDTWGLRQHRDGRWDWIAAPSKKQQAPEPRFQHSMVFIGSKMLVVGGRTDNDSTKPLSTAVYDTETVEWRFIASV
GRFRHSSWTLRSSIYTFGGFSHITQQHPTADLTLLDCCLIPNFYNEREREDLRRKQALQQEQQMAVASAVSAIQAPPAPA
APPAAPASASSPPSSALPAPSSAALLAVRGLPGQNGRDEKPRTSLPQTQGASPPTQQGQMPAQQSSQGGSAPLRPSWTFA
QRSQTRQLADIKLASHVSVVHETGEDFSSLVRRISIDRLEEEGKKINKEASLQEPLPTASESKRDMFADRILKLLLRPLI
TQQEVYATFNTDAPFAISWNDVTYLCDVVLDIVKNDDMVLHLRAPIKVYGDIHGQYYDLMRLFHLYKMPVEEERSDEFAG
TSGGQHGAATTSAVGDIDTNDYLFLGDYVDRGLNSLETICLLFALKVKYPRQIHLLRGNHEDPAINSLYGFQDECKRRLR
EDPFDPSSCWRKFNLVFEYLPVAAIIDDSILCIHGGIGGSISSVEELAAFQRPLKVAQVPQNVYEQRVTDLLWSDPTDND
SMLGVVRNDIRDPDGSGRIYKFGPDRVHRFLAENDLQLIIRAHECVMDGFERFAGGKLITLFSATNYCNHHQNAGALLFI
RRDMTIIPKLIYPANAPSQYNSWDSRMAELRPPTPPRAAPRMRETDFGAGG

Gene-Specific Links for TGME49_090170

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins