ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_090010 ()

proteasome subunit beta type 1, putative, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_11287

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • PFE0915c proteasome subunit beta type 1, putative
  • PBANKA_123310 proteasome subunit beta type 1, putative
  • PY02685 proteasome subunit beta type 1-related
  • PVX_080330 proteasome subunit beta type 1, putative
  • PCHAS_123370 proteasome subunit beta type 1, putative
  • PKH_101440 proteasome subunit beta type, putative
  • TGME49_090010 proteasome subunit beta type 1, putative
  • NCLIV_042370 hypothetical protein
  • cgd1_2490 proteasome subunit beta type 1, putative
  • Chro.10279 proteasome subunit beta type 1 (20S proteasome alpha subunit F) (20S proteasome subunit beta-6)
  • CMU_029260 proteasome subunit beta type 1, putative
  • TA07815 proteasome subunit, putative
  • BBOV_II002710 proteasome A-type and B-type family protein
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_090010 proteasome subunit beta type 1, putative
MHALRTQAHTWKKTRRTRLSRQRKRSNFVTLCFFVLLEIRPSELIAPNEQTLCSLSTESLTAQLQRLGFPNFLSVFVLVV
FFAFSITFSSVFFSSVFSFSPFSRFFSGAFNDSIMLAGGPASLPTSRLLHPEEEAILPVALAAPMERRFSPYVNNGGTVV
CVAGEDFAVAVGDTRLSTGFSIYSRRQSKITKLTDKVVLATSGMEADKTTLHNLLKIRIEQYTHQHRHPPSLNAIAQLLS
TVLYSRRFFPFYTFNVLCGIDENGKGAVYGYDAIGSFEPSRYNCAGTGAHLIMPVLDNQISRNNQQGEKAPLTRERIVEI
VKSAVASAGERDIFTGDQAEVVMISQSGIEKTLMDLRAD

Gene-Specific Links for TGME49_090010

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins