ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_089940 ()

uroporphyrinogen decarboxylase, putative, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10856

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • PBANKA_010590 uroporphyrinogen III decarboxylase, putative
  • PY02528 uroporphyrinogen decarboxylase, putative
  • PVX_113530 uroporphyrinogen decarboxylase, putative
  • PCHAS_010650 uroporphyrinogen III decarboxylase, putative
  • PKH_114200 uroporphyrinogen decarboxylase, putative
  • TGME49_089940 uroporphyrinogen decarboxylase, putative
  • NCLIV_042300 Uroporphyrinogen decarboxylase (EC 4.1.1.37), related
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_089940 uroporphyrinogen decarboxylase, putative
MQASSSSPSLLDERESSLPPRLSIFVCTKSMSVLHLLSRSRTPRPLRLRSPFSFVCLCFFVALFHFLGAFSTCRQLPVSS
RGDAAHMDMSWWRGPGVHTAHAYGFSEDRGETGLHSLAPSLSGNSSRTERHPHHVLPRVSQSQEERRETEERDSEDAARA
KNEWTAAEKEQLLQSSLGFFSGGVRSFFFPKGTANMTLESAGSERTDDAPPALYTLTPDDERALIRSQRTAYKANPREPL
VNDSLRRAALGPARYARLVEKTVELATAGRHGGDTEQKTVGEEPFLTPVWMMRQAGRYLPEFRNMRRQHGFLEVCRDPRL
ASELTLQPYRRFPQLDAVIIFSDILVIPEAMGMKLSMEEGVGPRFAWRIESPADMQKLNFKPDIEETLGYVFDAVYVTSQ
QLAGAIPLIGFCGGPLTLLTYMVEGGGSKTWRQAKKFVYEHPEATHTLLQVITDICVEYLVGQVDAGAQVLQVFDTNASQ
FAAETYDEIGAPYMASIAERVKARRPHVTMIAFPKDRPSAGFADSAFDVISLGSSAEIESMQRRFSGQCEEKIDQVTAGE
AELTRSDASATESDRDRKSDVRGDRKALQGNLDPQVLYTDTATIKRETAKMIRRFGVGRHIANLGHGMEPEMKPEHAKAF
IDGVKEASAAYIRELRGEGQDTSTV

Gene-Specific Links for TGME49_089940

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins